Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1210361..1210894 | Replicon | chromosome |
Accession | NZ_LT934425 | ||
Organism | Candidatus Kuenenia stuttgartiensis isolate kuenenia_mbr1_ru-nijmegen |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | KSMBR1_RS05560 | Protein ID | WP_099324421.1 |
Coordinates | 1210361..1210567 (+) | Length | 69 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KSMBR1_RS05565 | Protein ID | WP_099324422.1 |
Coordinates | 1210580..1210894 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KSMBR1_RS05535 | 1205862..1206071 | - | 210 | WP_099324419.1 | hypothetical protein | - |
KSMBR1_RS05545 | 1206482..1207585 | - | 1104 | WP_099323638.1 | IS4-like element ISCku3 family transposase | - |
KSMBR1_RS05550 | 1207654..1208007 | - | 354 | WP_197705356.1 | MBL fold metallo-hydrolase | - |
KSMBR1_RS21510 | 1208192..1208368 | - | 177 | WP_164994612.1 | hypothetical protein | - |
KSMBR1_RS05555 | 1208746..1210302 | + | 1557 | WP_099323647.1 | hypothetical protein | - |
KSMBR1_RS05560 | 1210361..1210567 | + | 207 | WP_099324421.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KSMBR1_RS05565 | 1210580..1210894 | + | 315 | WP_099324422.1 | HigA family addiction module antidote protein | Antitoxin |
KSMBR1_RS05570 | 1211261..1212037 | - | 777 | WP_099324423.1 | hypothetical protein | - |
KSMBR1_RS05575 | 1212169..1212354 | - | 186 | WP_099324424.1 | hypothetical protein | - |
KSMBR1_RS05580 | 1212430..1213284 | - | 855 | WP_099324425.1 | hypothetical protein | - |
KSMBR1_RS05585 | 1213646..1214242 | - | 597 | WP_099324426.1 | hypothetical protein | - |
KSMBR1_RS05590 | 1214467..1214625 | - | 159 | WP_099324427.1 | DUF3309 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1215118..1216221 | 1103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 8155.29 Da Isoelectric Point: 7.2776
>T293839 WP_099324421.1 NZ_LT934425:1210361-1210567 [Candidatus Kuenenia stuttgartiensis]
MQMRAFAKLNAIDAAIHLKDLHLPPSNRFEALKGERKEQYSIRINDRWRICFEWRNGNAEEVEIVDYH
MQMRAFAKLNAIDAAIHLKDLHLPPSNRFEALKGERKEQYSIRINDRWRICFEWRNGNAEEVEIVDYH
Download Length: 207 bp
Antitoxin
Download Length: 105 a.a. Molecular weight: 12280.28 Da Isoelectric Point: 10.4296
>AT293839 WP_099324422.1 NZ_LT934425:1210580-1210894 [Candidatus Kuenenia stuttgartiensis]
MAKRRITPVHPGVYLKELLDELKISQYRLSQDLGVPAMRINHVVHSKRPVTAELALRLGRYFGQSPRYWMNLQSRYDMDI
AEDALFEQVTREVRPFNGRFIIHK
MAKRRITPVHPGVYLKELLDELKISQYRLSQDLGVPAMRINHVVHSKRPVTAELALRLGRYFGQSPRYWMNLQSRYDMDI
AEDALFEQVTREVRPFNGRFIIHK
Download Length: 315 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|