Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 127493..127919 | Replicon | plasmid I |
| Accession | NZ_LT906556 | ||
| Organism | Escherichia coli isolate E. coli RL465 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | RL465_RS24260 | Protein ID | WP_001312861.1 |
| Coordinates | 127493..127651 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 127695..127919 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RL465_RS24230 | 122862..123551 | - | 690 | WP_000283380.1 | conjugal transfer transcriptional regulator TraJ | - |
| RL465_RS24235 | 123738..124121 | - | 384 | WP_053320747.1 | relaxosome protein TraM | - |
| RL465_RS24240 | 124442..125044 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| RL465_RS24245 | 125341..126162 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| RL465_RS24250 | 126284..126571 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| RL465_RS24255 | 126596..126802 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| RL465_RS24260 | 127493..127651 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 127695..127919 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127695..127919 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127695..127919 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127695..127919 | - | 225 | NuclAT_0 | - | Antitoxin |
| RL465_RS24265 | 127731..127919 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| RL465_RS24270 | 127931..128650 | - | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
| RL465_RS24275 | 128647..129081 | - | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
| RL465_RS24280 | 129136..131094 | - | 1959 | WP_023148339.1 | ParB/RepB/Spo0J family partition protein | - |
| RL465_RS24285 | 131160..131393 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| RL465_RS24290 | 131456..131995 | - | 540 | WP_000290791.1 | single-stranded DNA-binding protein | - |
| RL465_RS24295 | 132468..132716 | - | 249 | WP_071606928.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / aph(3')-Ia / sul3 / ant(3'')-Ia / dfrA1 / sitABCD | iroB / iroC / iroD / iroE / iroN | 1..157174 | 157174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T293787 WP_001312861.1 NZ_LT906556:c127651-127493 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 225 bp
>AT293787 NZ_LT906556:c127919-127695 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|