Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 36639..37294 | Replicon | chromosome |
| Accession | NZ_LT906484 | ||
| Organism | Bordetella pertussis strain NCTC13667 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | - |
| Locus tag | CKW08_RS00190 | Protein ID | WP_047122780.1 |
| Coordinates | 37043..37294 (-) | Length | 84 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | Q7VY40 |
| Locus tag | CKW08_RS00185 | Protein ID | WP_003809516.1 |
| Coordinates | 36639..37040 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKW08_RS00155 | 31822..32844 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
| CKW08_RS00160 | 32981..34018 | - | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
| CKW08_RS00165 | 34038..35228 | - | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
| CKW08_RS00170 | 35231..35746 | - | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
| CKW08_RS00175 | 35896..36375 | - | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
| CKW08_RS00180 | 36383..36619 | - | 237 | WP_010930404.1 | membrane protein | - |
| CKW08_RS00185 | 36639..37040 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| CKW08_RS00190 | 37043..37294 | - | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| CKW08_RS00195 | 37349..38230 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| CKW08_RS00200 | 38455..38901 | + | 447 | WP_003819827.1 | GFA family protein | - |
| CKW08_RS00205 | 38986..40050 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
| CKW08_RS00210 | 40187..40768 | - | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
| CKW08_RS00215 | 41003..42133 | + | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T293785 WP_047122780.1 NZ_LT906484:c37294-37043 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT293785 WP_003809516.1 NZ_LT906484:c37040-36639 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|