Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3385400..3386066 | Replicon | chromosome |
| Accession | NZ_LT906483 | ||
| Organism | Mycolicibacterium thermoresistibile strain NCTC10409 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | G7CGA7 |
| Locus tag | CKW28_RS15865 | Protein ID | WP_003925523.1 |
| Coordinates | 3385400..3385738 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CKW28_RS15870 | Protein ID | WP_040546732.1 |
| Coordinates | 3385740..3386066 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKW28_RS15845 | 3380546..3382198 | - | 1653 | WP_003925520.1 | arginine--tRNA ligase | - |
| CKW28_RS15850 | 3382410..3382859 | + | 450 | WP_003925521.1 | hypothetical protein | - |
| CKW28_RS15860 | 3383556..3385130 | + | 1575 | WP_003925522.1 | hypothetical protein | - |
| CKW28_RS15865 | 3385400..3385738 | + | 339 | WP_003925523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKW28_RS15870 | 3385740..3386066 | + | 327 | WP_040546732.1 | XRE family transcriptional regulator | Antitoxin |
| CKW28_RS23935 | 3386313..3386491 | - | 179 | Protein_3137 | YegP family protein | - |
| CKW28_RS15880 | 3386701..3387909 | + | 1209 | Protein_3138 | IS21 family transposase | - |
| CKW28_RS15890 | 3388818..3389246 | - | 429 | WP_061252274.1 | OB-fold domain-containing protein | - |
| CKW28_RS15895 | 3389248..3390438 | - | 1191 | WP_003890696.1 | thiolase family protein | - |
| CKW28_RS15900 | 3390519..3391037 | - | 519 | WP_003890697.1 | MaoC family dehydratase N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13074.88 Da Isoelectric Point: 5.2420
>T293784 WP_003925523.1 NZ_LT906483:3385400-3385738 [Mycolicibacterium thermoresistibile]
MWEVILVEEVEQWFFSLDPDVIDVVTGAIDRLEESGPALGRPTADRVKGSKYHHMKELRPAGTSIRILYIFDPTRRAVLL
VAGDKAGQWKKWYQDNIPVAEQRYERWFERGE
MWEVILVEEVEQWFFSLDPDVIDVVTGAIDRLEESGPALGRPTADRVKGSKYHHMKELRPAGTSIRILYIFDPTRRAVLL
VAGDKAGQWKKWYQDNIPVAEQRYERWFERGE
Download Length: 339 bp
Antitoxin
Download Length: 109 a.a. Molecular weight: 11949.75 Da Isoelectric Point: 10.4321
>AT293784 WP_040546732.1 NZ_LT906483:3385740-3386066 [Mycolicibacterium thermoresistibile]
MARSWRDVRAEAVASGRVDPARADAARRRMKVMEHAHTLAEVRKTLGMLRQEDIAQRMGVSQARVSKLERGDLAHTELGT
LLSYIQAMGGELKIEARIGDNSIDLIPA
MARSWRDVRAEAVASGRVDPARADAARRRMKVMEHAHTLAEVRKTLGMLRQEDIAQRMGVSQARVSKLERGDLAHTELGT
LLSYIQAMGGELKIEARIGDNSIDLIPA
Download Length: 327 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|