Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4199244..4199896 | Replicon | chromosome |
Accession | NZ_LT906479 | ||
Organism | Serratia ficaria strain NCTC12148 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | CKW09_RS19780 | Protein ID | WP_095099029.1 |
Coordinates | 4199244..4199588 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CKW09_RS19785 | Protein ID | WP_095099032.1 |
Coordinates | 4199594..4199896 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW09_RS19765 | 4194447..4196714 | - | 2268 | WP_095100278.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
CKW09_RS19770 | 4196936..4197955 | + | 1020 | WP_061796819.1 | HTH-type transcriptional regulator GalR | - |
CKW09_RS19775 | 4198094..4199104 | + | 1011 | WP_095099026.1 | LacI family DNA-binding transcriptional regulator | - |
CKW09_RS19780 | 4199244..4199588 | + | 345 | WP_095099029.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKW09_RS19785 | 4199594..4199896 | + | 303 | WP_095099032.1 | helix-turn-helix transcriptional regulator | Antitoxin |
CKW09_RS19790 | 4199925..4201187 | - | 1263 | WP_061796827.1 | diaminopimelate decarboxylase | - |
CKW09_RS19795 | 4201321..4202244 | + | 924 | WP_061796828.1 | LysR family transcriptional regulator | - |
CKW09_RS19800 | 4202234..4203388 | - | 1155 | WP_061796830.1 | MFS transporter | - |
CKW09_RS19805 | 4203707..4204615 | - | 909 | WP_095099035.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13252.31 Da Isoelectric Point: 10.1599
>T293777 WP_095099029.1 NZ_LT906479:4199244-4199588 [Serratia ficaria]
MWQVATVEIFDAWFLSLSGDQQKSILAGIFKLQEFGPQLARPYADTLHFPGSIHRMKELRIQHRGHPFRFFFAFDPQRQA
VLLCGGDKTGDKRFCQRLLPIAAREFSHYLATQR
MWQVATVEIFDAWFLSLSGDQQKSILAGIFKLQEFGPQLARPYADTLHFPGSIHRMKELRIQHRGHPFRFFFAFDPQRQA
VLLCGGDKTGDKRFCQRLLPIAAREFSHYLATQR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|