Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2653796..2655039 | Replicon | chromosome |
Accession | NZ_LT906476 | ||
Organism | Legionella pneumophila strain NCTC11286 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | - |
Locus tag | CKV96_RS12055 | Protein ID | WP_027224015.1 |
Coordinates | 2654101..2655039 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A1E5JNB7 |
Locus tag | CKV96_RS12050 | Protein ID | WP_027224016.1 |
Coordinates | 2653796..2654104 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV96_RS12030 | 2649323..2650447 | - | 1125 | WP_027224020.1 | UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) | - |
CKV96_RS12035 | 2650823..2652574 | - | 1752 | WP_027224019.1 | DUF927 domain-containing protein | - |
CKV96_RS12040 | 2652658..2652933 | - | 276 | WP_027224018.1 | helix-turn-helix domain-containing protein | - |
CKV96_RS12045 | 2653572..2653799 | + | 228 | WP_027224017.1 | helix-turn-helix transcriptional regulator | - |
CKV96_RS12050 | 2653796..2654104 | + | 309 | WP_027224016.1 | HipA N-terminal domain-containing protein | Antitoxin |
CKV96_RS12055 | 2654101..2655039 | + | 939 | WP_027224015.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
CKV96_RS12060 | 2655036..2655227 | - | 192 | WP_032829667.1 | hypothetical protein | - |
CKV96_RS12065 | 2655329..2655754 | - | 426 | WP_027224014.1 | helix-turn-helix domain-containing protein | - |
CKV96_RS12070 | 2655757..2656044 | - | 288 | WP_027224013.1 | type II toxin-antitoxin system HigB family toxin | - |
CKV96_RS12075 | 2656108..2657337 | - | 1230 | WP_027224012.1 | integrase family protein | - |
CKV96_RS12080 | 2657582..2658568 | - | 987 | WP_042236413.1 | IS30 family transposase | - |
CKV96_RS12085 | 2658750..2659538 | + | 789 | WP_014844522.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | lpg2370 | 2635516..2686180 | 50664 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36029.85 Da Isoelectric Point: 9.1296
>T293764 WP_027224015.1 NZ_LT906476:2654101-2655039 [Legionella pneumophila]
MKHCPITYEKISVQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQPMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISVQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQPMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|