Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 748826..749519 | Replicon | chromosome |
| Accession | NZ_LT906474 | ||
| Organism | Escherichia coli strain NCTC122 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | CKV98_RS03845 | Protein ID | WP_000415584.1 |
| Coordinates | 748826..749122 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | CKV98_RS03850 | Protein ID | WP_000650107.1 |
| Coordinates | 749124..749519 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV98_RS03805 | 743914..744228 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
| CKV98_RS03810 | 744259..744840 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| CKV98_RS03820 | 745159..745491 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| CKV98_RS03825 | 745537..746886 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
| CKV98_RS03830 | 746883..747542 | - | 660 | WP_081508774.1 | two-component system response regulator QseB | - |
| CKV98_RS03835 | 747694..748086 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| CKV98_RS03840 | 748139..748621 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
| CKV98_RS03845 | 748826..749122 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| CKV98_RS03850 | 749124..749519 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| CKV98_RS03855 | 749652..751259 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| CKV98_RS03860 | 751397..753655 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T293745 WP_000415584.1 NZ_LT906474:748826-749122 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT293745 WP_000650107.1 NZ_LT906474:749124-749519 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|