Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2904225..2904813 | Replicon | chromosome |
Accession | NZ_LT906473 | ||
Organism | Corynebacterium cystitidis strain NCTC11863 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | CKV99_RS13670 | Protein ID | WP_092258265.1 |
Coordinates | 2904225..2904506 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CKV99_RS13675 | Protein ID | WP_197697197.1 |
Coordinates | 2904514..2904813 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV99_RS13655 | 2900147..2901853 | + | 1707 | WP_092258271.1 | putative DNA binding domain-containing protein | - |
CKV99_RS13660 | 2902270..2902947 | + | 678 | WP_092258268.1 | hypothetical protein | - |
CKV99_RS13665 | 2903066..2904088 | + | 1023 | Protein_2658 | ATP-binding protein | - |
CKV99_RS13670 | 2904225..2904506 | + | 282 | WP_092258265.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKV99_RS13675 | 2904514..2904813 | + | 300 | WP_197697197.1 | HigA family addiction module antidote protein | Antitoxin |
CKV99_RS13680 | 2904870..2905604 | - | 735 | WP_092258260.1 | ABC transporter permease | - |
CKV99_RS13685 | 2905604..2906353 | - | 750 | WP_092258257.1 | ABC transporter permease | - |
CKV99_RS13690 | 2906350..2907261 | - | 912 | WP_092258254.1 | ABC transporter ATP-binding protein | - |
CKV99_RS13695 | 2907322..2907993 | - | 672 | WP_169872657.1 | response regulator transcription factor | - |
CKV99_RS13700 | 2907990..2909090 | - | 1101 | WP_143063430.1 | two-component sensor histidine kinase | - |
CKV99_RS13705 | 2909244..2909498 | - | 255 | WP_092258248.1 | Txe/YoeB family addiction module toxin | - |
CKV99_RS13710 | 2909509..2909769 | - | 261 | WP_092258246.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10945.53 Da Isoelectric Point: 9.8327
>T293741 WP_092258265.1 NZ_LT906473:2904225-2904506 [Corynebacterium cystitidis]
VIESFRDKHTEDLWLNHRSAKIPSEILRKAVKQLKMLDFATSLDDLRIPPGNRLEKLTGDRKGQHSIRINHQWRVCFTWI
DGAARNVEIVDYH
VIESFRDKHTEDLWLNHRSAKIPSEILRKAVKQLKMLDFATSLDDLRIPPGNRLEKLTGDRKGQHSIRINHQWRVCFTWI
DGAARNVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|