Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1538765..1539354 | Replicon | chromosome |
Accession | NZ_LT906473 | ||
Organism | Corynebacterium cystitidis strain NCTC11863 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | CKV99_RS07220 | Protein ID | WP_092256838.1 |
Coordinates | 1539073..1539354 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | CKV99_RS07215 | Protein ID | WP_092256841.1 |
Coordinates | 1538765..1539064 (-) | Length | 100 a.a. |
Genomic Context
Location: 1533945..1534742 (798 bp)
Type: Others
Protein ID: WP_092257332.1
Type: Others
Protein ID: WP_092257332.1
Location: 1535288..1536694 (1407 bp)
Type: Others
Protein ID: WP_092256849.1
Type: Others
Protein ID: WP_092256849.1
Location: 1536743..1538305 (1563 bp)
Type: Others
Protein ID: WP_157728391.1
Type: Others
Protein ID: WP_157728391.1
Location: 1538302..1538571 (270 bp)
Type: Others
Protein ID: WP_092256844.1
Type: Others
Protein ID: WP_092256844.1
Location: 1540554..1542023 (1470 bp)
Type: Others
Protein ID: WP_092257329.1
Type: Others
Protein ID: WP_092257329.1
Location: 1542053..1543147 (1095 bp)
Type: Others
Protein ID: WP_092257327.1
Type: Others
Protein ID: WP_092257327.1
Location: 1543283..1543888 (606 bp)
Type: Others
Protein ID: WP_092256830.1
Type: Others
Protein ID: WP_092256830.1
Location: 1534739..1535245 (507 bp)
Type: Others
Protein ID: WP_092256852.1
Type: Others
Protein ID: WP_092256852.1
Location: 1538765..1539064 (300 bp)
Type: Antitoxin
Protein ID: WP_092256841.1
Type: Antitoxin
Protein ID: WP_092256841.1
Location: 1539073..1539354 (282 bp)
Type: Toxin
Protein ID: WP_092256838.1
Type: Toxin
Protein ID: WP_092256838.1
Location: 1539395..1540480 (1086 bp)
Type: Others
Protein ID: WP_092256835.1
Type: Others
Protein ID: WP_092256835.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV99_RS07190 | 1533945..1534742 | + | 798 | WP_092257332.1 | fused MFS/spermidine synthase | - |
CKV99_RS07195 | 1534739..1535245 | - | 507 | WP_092256852.1 | 2'-5' RNA ligase family protein | - |
CKV99_RS07200 | 1535288..1536694 | + | 1407 | WP_092256849.1 | DNA photolyase family protein | - |
CKV99_RS07205 | 1536743..1538305 | + | 1563 | WP_157728391.1 | DNA/RNA non-specific endonuclease | - |
CKV99_RS07210 | 1538302..1538571 | + | 270 | WP_092256844.1 | hypothetical protein | - |
CKV99_RS07215 | 1538765..1539064 | - | 300 | WP_092256841.1 | HigA family addiction module antidote protein | Antitoxin |
CKV99_RS07220 | 1539073..1539354 | - | 282 | WP_092256838.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CKV99_RS07225 | 1539395..1540480 | - | 1086 | WP_092256835.1 | redox-regulated ATPase YchF | - |
CKV99_RS07230 | 1540554..1542023 | + | 1470 | WP_092257329.1 | AI-2E family transporter | - |
CKV99_RS07235 | 1542053..1543147 | + | 1095 | WP_092257327.1 | DNA recombination protein RmuC | - |
CKV99_RS07240 | 1543283..1543888 | + | 606 | WP_092256830.1 | MFS transporter | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10906.57 Da Isoelectric Point: 10.3438
>T293739 WP_092256838.1 NZ_LT906473:c1539354-1539073 [Corynebacterium cystitidis]
VIVSFADKDTERLFRRQRPKRIDTRLQRRALSKLLVLNAAVKLEELKVPPGNQLELLSGDRVGQHSIRINSQWRICFVWT
DEGPRDVEIVDYH
VIVSFADKDTERLFRRQRPKRIDTRLQRRALSKLLVLNAAVKLEELKVPPGNQLELLSGDRVGQHSIRINSQWRICFVWT
DEGPRDVEIVDYH
Download Length: 282 bp