Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2807779..2808434 | Replicon | chromosome |
Accession | NZ_LT906471 | ||
Organism | Bordetella pertussis strain NCTC13666 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | CKW12_RS13565 | Protein ID | WP_047122780.1 |
Coordinates | 2808183..2808434 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | CKW12_RS13560 | Protein ID | WP_003809516.1 |
Coordinates | 2807779..2808180 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW12_RS13530 | 2802962..2803984 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
CKW12_RS13535 | 2804121..2805158 | - | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
CKW12_RS13540 | 2805178..2806368 | - | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
CKW12_RS13545 | 2806371..2806886 | - | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
CKW12_RS13550 | 2807036..2807515 | - | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
CKW12_RS13555 | 2807523..2807759 | - | 237 | WP_010930404.1 | membrane protein | - |
CKW12_RS13560 | 2807779..2808180 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
CKW12_RS13565 | 2808183..2808434 | - | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
CKW12_RS13570 | 2808489..2809370 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
CKW12_RS13575 | 2809595..2810041 | + | 447 | WP_003819827.1 | GFA family protein | - |
CKW12_RS13580 | 2810126..2811190 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
CKW12_RS13585 | 2811327..2811908 | - | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
CKW12_RS13590 | 2812143..2813273 | + | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T293737 WP_047122780.1 NZ_LT906471:c2808434-2808183 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT293737 WP_003809516.1 NZ_LT906471:c2808180-2807779 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|