Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 79789..79937 | Replicon | chromosome |
Accession | NZ_LT906462 | ||
Organism | Mammaliicoccus stepanovicii strain NCTC13839 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | CKV64_RS12085 | Protein ID | WP_103268485.1 |
Coordinates | 79842..79937 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 79789..79824 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKV64_RS00325 | 75460..75702 | - | 243 | WP_095085252.1 | hypothetical protein | - |
CKV64_RS00330 | 75995..76933 | + | 939 | WP_095085253.1 | TDT family transporter | - |
CKV64_RS00335 | 77109..78666 | + | 1558 | Protein_65 | MFS transporter | - |
CKV64_RS00340 | 78747..79655 | + | 909 | WP_095085254.1 | alpha/beta hydrolase | - |
- | 79789..79824 | - | 36 | - | - | Antitoxin |
CKV64_RS12085 | 79842..79937 | - | 96 | WP_103268485.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
CKV64_RS00345 | 80171..80866 | + | 696 | WP_095085255.1 | DUF969 domain-containing protein | - |
CKV64_RS00350 | 80859..81785 | + | 927 | WP_095085256.1 | DUF979 domain-containing protein | - |
CKV64_RS00355 | 81808..82449 | + | 642 | WP_095085257.1 | pyroglutamyl-peptidase I | - |
CKV64_RS00360 | 82587..83546 | + | 960 | WP_095085258.1 | extracellular solute-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T293726 WP_103268485.1 NZ_LT906462:c79937-79842 [Mammaliicoccus stepanovicii]
ILEILVHIMTTVISGCTIALFTHWLRKRNDK
ILEILVHIMTTVISGCTIALFTHWLRKRNDK
Download Length: 96 bp
Antitoxin
Download Length: 36 bp
>AT293726 NZ_LT906462:c79824-79789 [Mammaliicoccus stepanovicii]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|