Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
| Location | 2505476..2505634 | Replicon | chromosome |
| Accession | NZ_LT906460 | ||
| Organism | Staphylococcus simiae strain NCTC13838 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | - |
| Locus tag | CKV88_RS12515 | Protein ID | WP_002463737.1 |
| Coordinates | 2505476..2505571 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2505596..2505634 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV88_RS11770 | 2501048..2501527 | - | 480 | WP_002463725.1 | hypothetical protein | - |
| CKV88_RS11775 | 2501743..2502189 | + | 447 | WP_002463727.1 | glyoxalase/bleomycin resistance/extradiol dioxygenase family protein | - |
| CKV88_RS11780 | 2502347..2502730 | - | 384 | WP_040801911.1 | aspartate 1-decarboxylase | - |
| CKV88_RS11785 | 2502730..2503584 | - | 855 | WP_002463732.1 | pantoate--beta-alanine ligase | - |
| CKV88_RS11790 | 2503577..2504395 | - | 819 | WP_002463734.1 | 3-methyl-2-oxobutanoate hydroxymethyltransferase | - |
| CKV88_RS11795 | 2504468..2505334 | + | 867 | WP_002463736.1 | oxidoreductase | - |
| CKV88_RS12515 | 2505476..2505571 | + | 96 | WP_002463737.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 2505596..2505634 | - | 39 | - | - | Antitoxin |
| CKV88_RS11800 | 2505770..2506474 | - | 705 | WP_002463739.1 | acetolactate decarboxylase | - |
| CKV88_RS11805 | 2506750..2507709 | - | 960 | WP_002463741.1 | L-lactate dehydrogenase | - |
| CKV88_RS11810 | 2508255..2509703 | + | 1449 | WP_002463743.1 | amino acid permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3531.15 Da Isoelectric Point: 9.6659
>T293722 WP_002463737.1 NZ_LT906460:2505476-2505571 [Staphylococcus simiae]
MLETLVNTATTVISGCIIALFTHWLRNRNNK
MLETLVNTATTVISGCIIALFTHWLRNRNNK
Download Length: 96 bp
Antitoxin
Download Length: 39 bp
>AT293722 NZ_LT906460:c2505634-2505596 [Staphylococcus simiae]
TATGCACCTAGTCCCCTCACTATTTGCGGTAGTGAGGGG
TATGCACCTAGTCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|