Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-SprA2AS/- |
| Location | 1372390..1372569 | Replicon | chromosome |
| Accession | NZ_LT906460 | ||
| Organism | Staphylococcus simiae strain NCTC13838 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | CKV88_RS12485 | Protein ID | WP_002465043.1 |
| Coordinates | 1372474..1372569 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 1372390..1372448 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV88_RS06335 | 1368470..1369417 | - | 948 | WP_002465040.1 | phosphate ABC transporter substrate-binding protein PstS family protein | - |
| CKV88_RS06340 | 1369681..1370586 | - | 906 | WP_002465041.1 | RNA-binding virulence regulatory protein CvfB | - |
| CKV88_RS06345 | 1370732..1372333 | + | 1602 | WP_002465042.1 | ATP-binding cassette domain-containing protein | - |
| - | 1372390..1372448 | + | 59 | - | - | Antitoxin |
| CKV88_RS12485 | 1372474..1372569 | - | 96 | WP_002465043.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CKV88_RS06350 | 1374163..1375365 | + | 1203 | WP_002462932.1 | aspartate kinase | - |
| CKV88_RS06355 | 1375429..1376418 | + | 990 | WP_002462930.1 | aspartate-semialdehyde dehydrogenase | - |
| CKV88_RS06360 | 1376420..1377304 | + | 885 | WP_002462928.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3479.21 Da Isoelectric Point: 9.2007
>T293716 WP_002465043.1 NZ_LT906460:c1372569-1372474 [Staphylococcus simiae]
MSMVIINVLGTIISGCAIAFFTYWLNEKSKK
MSMVIINVLGTIISGCAIAFFTYWLNEKSKK
Download Length: 96 bp
Antitoxin
Download Length: 59 bp
>AT293716 NZ_LT906460:1372390-1372448 [Staphylococcus simiae]
ACATTATAACCATTGACATGGCAAACACAAATCCCCTCACTACTGCCATAGTGAGGGGA
ACATTATAACCATTGACATGGCAAACACAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|