Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-MqsA |
| Location | 2046371..2047025 | Replicon | chromosome |
| Accession | NZ_LT906456 | ||
| Organism | Actinobacillus suis strain NCTC12996 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0G6E5 |
| Locus tag | CKV75_RS09490 | Protein ID | WP_015674148.1 |
| Coordinates | 2046663..2047025 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CKV75_RS09485 | Protein ID | WP_015674147.1 |
| Coordinates | 2046371..2046679 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV75_RS09460 | 2041516..2042082 | - | 567 | WP_015674143.1 | septal ring lytic transglycosylase RlpA family protein | - |
| CKV75_RS09465 | 2042257..2043381 | - | 1125 | WP_015674144.1 | rod shape-determining protein RodA | - |
| CKV75_RS09470 | 2043374..2045344 | - | 1971 | WP_015674145.1 | penicillin-binding protein 2 | - |
| CKV75_RS09475 | 2045427..2045894 | - | 468 | WP_005598965.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| CKV75_RS09480 | 2045917..2046231 | - | 315 | WP_015674146.1 | ribosome silencing factor | - |
| CKV75_RS09485 | 2046371..2046679 | - | 309 | WP_015674147.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| CKV75_RS09490 | 2046663..2047025 | - | 363 | WP_015674148.1 | hypothetical protein | Toxin |
| CKV75_RS09495 | 2047199..2049793 | - | 2595 | WP_039195494.1 | DNA mismatch repair protein MutS | - |
| CKV75_RS09500 | 2049959..2050708 | - | 750 | WP_015674150.1 | amino acid ABC transporter ATP-binding protein | - |
| CKV75_RS09505 | 2050730..2051446 | - | 717 | WP_005605560.1 | amino acid ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14051.07 Da Isoelectric Point: 10.2511
>T293709 WP_015674148.1 NZ_LT906456:c2047025-2046663 [Actinobacillus suis]
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSSNGKTF
VKLVFVELPPFERYRQKHLSDEEYRHFQNELLENPNKGDLIQGTNGLRKIRIADMQRNKGKRGGARVIYYHIVNYSKILL
VTAYGKDEQSDLSNTERNMLANKVKRIVELEIRSSNGKTF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|