Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1273290..1273935 | Replicon | chromosome |
| Accession | NZ_LT906456 | ||
| Organism | Actinobacillus suis strain NCTC12996 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | K0G4M5 |
| Locus tag | CKV75_RS05840 | Protein ID | WP_014991853.1 |
| Coordinates | 1273591..1273935 (-) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | CKV75_RS05835 | Protein ID | WP_014991852.1 |
| Coordinates | 1273290..1273586 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV75_RS05810 | 1268467..1269471 | - | 1005 | WP_005600359.1 | Holliday junction branch migration DNA helicase RuvB | - |
| CKV75_RS05815 | 1269490..1270095 | - | 606 | WP_014991848.1 | Holliday junction branch migration protein RuvA | - |
| CKV75_RS05820 | 1270237..1271004 | - | 768 | WP_014991849.1 | spermidine/putrescine ABC transporter permease PotC | - |
| CKV75_RS05825 | 1271004..1271870 | - | 867 | WP_014991850.1 | spermidine/putrescine ABC transporter permease PotB | - |
| CKV75_RS05830 | 1271857..1272972 | - | 1116 | WP_014991851.1 | spermidine/putrescine ABC transporter ATP-binding protein PotA | - |
| CKV75_RS05835 | 1273290..1273586 | - | 297 | WP_014991852.1 | helix-turn-helix domain-containing protein | Antitoxin |
| CKV75_RS05840 | 1273591..1273935 | - | 345 | WP_014991853.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKV75_RS05845 | 1274140..1276158 | + | 2019 | WP_014991854.1 | DNA helicase Rep | - |
| CKV75_RS05850 | 1276247..1276999 | - | 753 | WP_014991855.1 | TatD family hydrolase | - |
| CKV75_RS05855 | 1277093..1278244 | - | 1152 | WP_039195223.1 | methionine adenosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13348.34 Da Isoelectric Point: 7.9875
>T293706 WP_014991853.1 NZ_LT906456:c1273935-1273591 [Actinobacillus suis]
MNSDEYLTFVEVGTFEEDRKQLMADDEYQLFQAYLLEHYELGDFISHTGGCQKIRWRLPENNKGKSAGVRIIYYVRSLTG
RIYLITMYGKSEKVNLNAREKAIMKKIISRLIGE
MNSDEYLTFVEVGTFEEDRKQLMADDEYQLFQAYLLEHYELGDFISHTGGCQKIRWRLPENNKGKSAGVRIIYYVRSLTG
RIYLITMYGKSEKVNLNAREKAIMKKIISRLIGE
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|