Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2874052..2875295 | Replicon | chromosome |
Accession | NZ_LT906442 | ||
Organism | Legionella waltersii strain NCTC13017 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | A0A0W1A1C6 |
Locus tag | CKW04_RS13285 | Protein ID | WP_058481808.1 |
Coordinates | 2874357..2875295 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | A0A0W1A1I4 |
Locus tag | CKW04_RS13280 | Protein ID | WP_058481807.1 |
Coordinates | 2874052..2874360 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CKW04_RS13250 | 2869490..2869873 | - | 384 | Protein_2591 | DUF4102 domain-containing protein | - |
CKW04_RS13255 | 2870308..2871068 | - | 761 | Protein_2592 | DEAD/DEAH box helicase family protein | - |
CKW04_RS13260 | 2871091..2872191 | - | 1101 | WP_058481803.1 | hypothetical protein | - |
CKW04_RS13265 | 2872562..2873044 | - | 483 | Protein_2594 | IS982 family transposase | - |
CKW04_RS13270 | 2873048..2873440 | - | 393 | WP_133141277.1 | hypothetical protein | - |
CKW04_RS13275 | 2873828..2874055 | + | 228 | WP_058481806.1 | helix-turn-helix transcriptional regulator | - |
CKW04_RS13280 | 2874052..2874360 | + | 309 | WP_058481807.1 | HipA N-terminal domain-containing protein | Antitoxin |
CKW04_RS13285 | 2874357..2875295 | + | 939 | WP_058481808.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
CKW04_RS13290 | 2875418..2875651 | + | 234 | Protein_2599 | DUF2779 domain-containing protein | - |
CKW04_RS13295 | 2875826..2876008 | - | 183 | WP_058481810.1 | hypothetical protein | - |
CKW04_RS13305 | 2876642..2877301 | - | 660 | WP_058481946.1 | hypothetical protein | - |
CKW04_RS13310 | 2877258..2877881 | - | 624 | WP_133141276.1 | hypothetical protein | - |
CKW04_RS13315 | 2878162..2878689 | - | 528 | WP_058481811.1 | hypothetical protein | - |
CKW04_RS13320 | 2878797..2879654 | - | 858 | WP_058481812.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | sidB / lem8 / lpg2370 | 2766469..2900080 | 133611 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36074.92 Da Isoelectric Point: 9.2554
>T293689 WP_058481808.1 NZ_LT906442:2874357-2875295 [Legionella waltersii]
MKHCPITYEKISVQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGYFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQPMQEKYLELLELRCKRLNFFD
MKHCPITYEKISVQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGYFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQPMQEKYLELLELRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W1A1C6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W1A1I4 |