Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1357975..1358540 | Replicon | chromosome |
| Accession | NZ_LT906434 | ||
| Organism | Neisseria zoodegmatis strain NCTC12230 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | CKV66_RS06375 | Protein ID | WP_085363808.1 |
| Coordinates | 1358262..1358540 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | CKV66_RS06370 | Protein ID | WP_085363831.1 |
| Coordinates | 1357975..1358250 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CKV66_RS06350 | 1353069..1353455 | + | 387 | WP_085363812.1 | MliC family protein | - |
| CKV66_RS06355 | 1353594..1354430 | - | 837 | WP_085363811.1 | hypothetical protein | - |
| CKV66_RS06360 | 1354516..1355991 | - | 1476 | WP_085363810.1 | anthranilate synthase component I | - |
| CKV66_RS06365 | 1356242..1357249 | - | 1008 | WP_085363809.1 | IS5 family transposase | - |
| CKV66_RS12180 | 1357408..1357572 | + | 165 | WP_157739153.1 | hypothetical protein | - |
| CKV66_RS06370 | 1357975..1358250 | - | 276 | WP_085363831.1 | HigA family addiction module antidote protein | Antitoxin |
| CKV66_RS06375 | 1358262..1358540 | - | 279 | WP_085363808.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CKV66_RS06385 | 1359004..1360383 | - | 1380 | WP_085363806.1 | DNA repair protein RadA | - |
| CKV66_RS06390 | 1360623..1361432 | + | 810 | WP_158087794.1 | sel1 repeat family protein | - |
| CKV66_RS06395 | 1361774..1361992 | + | 219 | WP_085363804.1 | sulfurtransferase TusA family protein | - |
| CKV66_RS06400 | 1362004..1362591 | + | 588 | WP_085363803.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | pilW | 1329373..1513637 | 184264 | |
| - | flank | IS/Tn | - | - | 1356242..1357249 | 1007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10532.90 Da Isoelectric Point: 10.2615
>T293673 WP_085363808.1 NZ_LT906434:c1358540-1358262 [Neisseria zoodegmatis]
MIKSFKHKGLAIFFETGNKAGIQANHAEKLKLQLSALNRATSPRDVNAPGWQLHQLSGNLKDHWSIKVNGNWRITFRFNG
NDVEVVDYQDYH
MIKSFKHKGLAIFFETGNKAGIQANHAEKLKLQLSALNRATSPRDVNAPGWQLHQLSGNLKDHWSIKVNGNWRITFRFNG
NDVEVVDYQDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|