Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4351305..4351923 | Replicon | chromosome |
| Accession | NZ_LT903847 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | BQ9550_RS23235 | Protein ID | WP_001291435.1 |
| Coordinates | 4351705..4351923 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | BQ9550_RS23230 | Protein ID | WP_000344800.1 |
| Coordinates | 4351305..4351679 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9550_RS23220 | 4346395..4347588 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| BQ9550_RS23225 | 4347611..4350760 | + | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
| BQ9550_RS23230 | 4351305..4351679 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| BQ9550_RS23235 | 4351705..4351923 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| BQ9550_RS23240 | 4352097..4352649 | + | 553 | Protein_4265 | maltose O-acetyltransferase | - |
| BQ9550_RS23245 | 4352765..4353235 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| BQ9550_RS23250 | 4353399..4354949 | + | 1551 | WP_001386100.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| BQ9550_RS23255 | 4354991..4355344 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| BQ9550_RS23265 | 4355723..4356034 | + | 312 | WP_000409907.1 | MGMT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 4356060..4357433 | 1373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T293655 WP_001291435.1 NZ_LT903847:4351705-4351923 [Escherichia coli O127:H6]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT293655 WP_000344800.1 NZ_LT903847:4351305-4351679 [Escherichia coli O127:H6]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |