Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3199605..3200167 | Replicon | chromosome |
Accession | NZ_LT903847 | ||
Organism | Escherichia coli O127:H6 isolate EPEC1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | BQ9550_RS16795 | Protein ID | WP_000605675.1 |
Coordinates | 3199605..3199883 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BQ9550_RS16800 | Protein ID | WP_000781364.1 |
Coordinates | 3199883..3200167 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9550_RS16765 | 3195192..3195623 | - | 432 | WP_000152307.1 | peroxiredoxin OsmC | - |
BQ9550_RS16775 | 3195968..3196183 | + | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
BQ9550_RS16780 | 3196285..3196422 | + | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
BQ9550_RS16785 | 3196578..3198275 | + | 1698 | WP_000433462.1 | malate dehydrogenase | - |
BQ9550_RS16790 | 3198409..3199419 | + | 1011 | WP_000642413.1 | alcohol dehydrogenase AdhP | - |
BQ9550_RS16795 | 3199605..3199883 | + | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BQ9550_RS16800 | 3199883..3200167 | + | 285 | WP_000781364.1 | HigA family addiction module antidote protein | Antitoxin |
BQ9550_RS16805 | 3200218..3200871 | - | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
BQ9550_RS16810 | 3200864..3201748 | - | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
BQ9550_RS16815 | 3201761..3204808 | - | 3048 | WP_012578903.1 | formate dehydrogenase-N subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T293651 WP_000605675.1 NZ_LT903847:3199605-3199883 [Escherichia coli O127:H6]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|