Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 574450..575052 | Replicon | chromosome |
| Accession | NZ_LT903847 | ||
| Organism | Escherichia coli O127:H6 isolate EPEC1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | BQ9550_RS02895 | Protein ID | WP_000897305.1 |
| Coordinates | 574741..575052 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | BQ9550_RS02890 | Protein ID | WP_000356397.1 |
| Coordinates | 574450..574740 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ9550_RS02870 | 570943..571845 | + | 903 | WP_000331385.1 | formate dehydrogenase O subunit beta | - |
| BQ9550_RS02875 | 571842..572477 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| BQ9550_RS02880 | 572474..573403 | + | 930 | WP_000027712.1 | formate dehydrogenase accessory protein FdhE | - |
| BQ9550_RS02885 | 573627..573845 | - | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
| BQ9550_RS02890 | 574450..574740 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| BQ9550_RS02895 | 574741..575052 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| BQ9550_RS02900 | 575281..576189 | + | 909 | WP_001386513.1 | alpha/beta hydrolase | - |
| BQ9550_RS02905 | 576253..577194 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| BQ9550_RS02910 | 577239..577676 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| BQ9550_RS02915 | 577673..578545 | - | 873 | WP_000920747.1 | virulence factor BrkB family protein | - |
| BQ9550_RS02920 | 578539..579138 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T293639 WP_000897305.1 NZ_LT903847:c575052-574741 [Escherichia coli O127:H6]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|