Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
Location | 3008022..3008569 | Replicon | chromosome |
Accession | NZ_LT900217 | ||
Organism | Gordonibacter urolithinfaciens strain DSM 27213T |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | BN3560_RS12875 | Protein ID | WP_087190613.1 |
Coordinates | 3008276..3008569 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | BN3560_RS12870 | Protein ID | WP_087190612.1 |
Coordinates | 3008022..3008273 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3560_RS12845 | 3003400..3004068 | + | 669 | WP_015539919.1 | TetR/AcrR family transcriptional regulator | - |
BN3560_RS12850 | 3004093..3004317 | - | 225 | WP_096228356.1 | hypothetical protein | - |
BN3560_RS12855 | 3004362..3004904 | - | 543 | WP_096228357.1 | hypothetical protein | - |
BN3560_RS12860 | 3005016..3005375 | - | 360 | WP_096228358.1 | oxidoreductase | - |
BN3560_RS12865 | 3005375..3007753 | - | 2379 | WP_161959474.1 | molybdopterin-dependent oxidoreductase | - |
BN3560_RS12870 | 3008022..3008273 | + | 252 | WP_087190612.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
BN3560_RS12875 | 3008276..3008569 | + | 294 | WP_087190613.1 | Txe/YoeB family addiction module toxin | Toxin |
BN3560_RS12880 | 3008606..3010066 | - | 1461 | WP_096228360.1 | helix-turn-helix transcriptional regulator | - |
BN3560_RS12885 | 3010320..3010592 | - | 273 | WP_087190615.1 | hypothetical protein | - |
BN3560_RS12890 | 3010703..3012088 | - | 1386 | WP_096228361.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10950.62 Da Isoelectric Point: 9.5769
>T293635 WP_087190613.1 NZ_LT900217:3008276-3008569 [Gordonibacter urolithinfaciens]
MYAVKFTKQAAKDAKKLKAAGLDKKAKALVEVLKNDPFQEAPAYETLVGNLSGLYSRRINLQHRLVYQVYAEPFAEGGEE
FDGTVKVVRMWTHYEGL
MYAVKFTKQAAKDAKKLKAAGLDKKAKALVEVLKNDPFQEAPAYETLVGNLSGLYSRRINLQHRLVYQVYAEPFAEGGEE
FDGTVKVVRMWTHYEGL
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|