Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 51723..52394 | Replicon | chromosome |
Accession | NZ_LT900217 | ||
Organism | Gordonibacter urolithinfaciens strain DSM 27213T |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | BN3560_RS00240 | Protein ID | WP_096226529.1 |
Coordinates | 52029..52394 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BN3560_RS00235 | Protein ID | WP_096226528.1 |
Coordinates | 51723..52025 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3560_RS00215 | 46839..48236 | - | 1398 | WP_087189762.1 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | - |
BN3560_RS00220 | 48245..48601 | - | 357 | WP_087189761.1 | stage V sporulation protein S | - |
BN3560_RS00225 | 48774..49859 | - | 1086 | WP_096226526.1 | ATP-binding protein | - |
BN3560_RS00230 | 49872..51404 | - | 1533 | WP_096226527.1 | ribonuclease Y | - |
BN3560_RS00235 | 51723..52025 | - | 303 | WP_096226528.1 | XRE family transcriptional regulator | Antitoxin |
BN3560_RS00240 | 52029..52394 | - | 366 | WP_096226529.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN3560_RS00245 | 52476..53282 | - | 807 | WP_096226530.1 | RecX family transcriptional regulator | - |
BN3560_RS00250 | 53284..54342 | - | 1059 | WP_087189757.1 | recombinase RecA | - |
BN3560_RS00255 | 54628..55899 | - | 1272 | WP_096226531.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
BN3560_RS00260 | 55909..57237 | - | 1329 | WP_096226532.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13929.99 Da Isoelectric Point: 7.9099
>T293633 WP_096226529.1 NZ_LT900217:c52394-52029 [Gordonibacter urolithinfaciens]
MGWHVDIDLIKPWLDTQDLVTVSCIEAAIEELERKGPSLGRPLVDHIKDSEFCNMKELRPASPGRSEVRILFAFDPKRHA
IMLFAGDKSSGGRSREKWNGWYRSAIPLAEKRYREHLGRLE
MGWHVDIDLIKPWLDTQDLVTVSCIEAAIEELERKGPSLGRPLVDHIKDSEFCNMKELRPASPGRSEVRILFAFDPKRHA
IMLFAGDKSSGGRSREKWNGWYRSAIPLAEKRYREHLGRLE
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|