Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3694962..3695656 | Replicon | chromosome |
| Accession | NZ_LT883142 | ||
| Organism | Escherichia coli isolate 6666666.257727.embl | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | EC1094V2_RS20750 | Protein ID | WP_096321276.1 |
| Coordinates | 3694962..3695360 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | EC1094V2_RS20755 | Protein ID | WP_000554757.1 |
| Coordinates | 3695363..3695656 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1094V2_RS20720 | 3689962..3691206 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| - | 3690622..3690702 | - | 81 | NuclAT_9 | - | - |
| - | 3690622..3690702 | - | 81 | NuclAT_9 | - | - |
| - | 3690622..3690702 | - | 81 | NuclAT_9 | - | - |
| - | 3690622..3690702 | - | 81 | NuclAT_9 | - | - |
| EC1094V2_RS20725 | 3691298..3691756 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| EC1094V2_RS20730 | 3692017..3693474 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| EC1094V2_RS20735 | 3693531..3694052 | - | 522 | Protein_3488 | peptide chain release factor H | - |
| EC1094V2_RS20740 | 3694051..3694254 | - | 204 | Protein_3489 | RNA ligase RtcB family protein | - |
| EC1094V2_RS20745 | 3694500..3694952 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| EC1094V2_RS20750 | 3694962..3695360 | - | 399 | WP_096321276.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| EC1094V2_RS20755 | 3695363..3695656 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| EC1094V2_RS20760 | 3695708..3696763 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| EC1094V2_RS20765 | 3696834..3697619 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
| EC1094V2_RS20770 | 3697591..3699303 | + | 1713 | Protein_3495 | flagellar biosynthesis protein FlhA | - |
| EC1094V2_RS20775 | 3699567..3700016 | - | 450 | WP_096321275.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15414.79 Da Isoelectric Point: 8.9511
>T293603 WP_096321276.1 NZ_LT883142:c3695360-3694962 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDAQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDAQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|