Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 508333..509132 | Replicon | chromosome |
Accession | NZ_LT883142 | ||
Organism | Escherichia coli isolate 6666666.257727.embl |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | EC1094V2_RS04270 | Protein ID | WP_000347251.1 |
Coordinates | 508333..508797 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | EC1094V2_RS04275 | Protein ID | WP_001307405.1 |
Coordinates | 508797..509132 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1094V2_RS04235 | 503334..503768 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
EC1094V2_RS04240 | 503786..504664 | - | 879 | WP_001300474.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
EC1094V2_RS04245 | 504654..505433 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
EC1094V2_RS04250 | 505444..505917 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
EC1094V2_RS04255 | 505940..507220 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
EC1094V2_RS04265 | 507469..508278 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
EC1094V2_RS04270 | 508333..508797 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
EC1094V2_RS04275 | 508797..509132 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
EC1094V2_RS04280 | 509281..510852 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
EC1094V2_RS04285 | 511227..512561 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
EC1094V2_RS04290 | 512577..513347 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T293588 WP_000347251.1 NZ_LT883142:c508797-508333 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |