Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 66401..67128 | Replicon | plasmid III |
Accession | NZ_LT883141 | ||
Organism | Escherichia coli isolate 6666666.257727.embl |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A663AUB1 |
Locus tag | EC1094V2_RS01275 | Protein ID | WP_000558568.1 |
Coordinates | 66817..67128 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | V0AHC4 |
Locus tag | EC1094V2_RS01270 | Protein ID | WP_000990392.1 |
Coordinates | 66401..66820 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1094V2_RS01245 | 62727..63032 | - | 306 | WP_016156495.1 | hypothetical protein | - |
EC1094V2_RS01250 | 63086..63337 | - | 252 | WP_004118488.1 | plasmid stabilization protein | - |
EC1094V2_RS01255 | 63416..64675 | - | 1260 | WP_029404075.1 | Y-family DNA polymerase | - |
EC1094V2_RS01260 | 64711..65415 | + | 705 | WP_061872725.1 | IS6-like element IS26 family transposase | - |
EC1094V2_RS01265 | 66155..66364 | + | 210 | WP_020806042.1 | hypothetical protein | - |
EC1094V2_RS01270 | 66401..66820 | - | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
EC1094V2_RS01275 | 66817..67128 | - | 312 | WP_000558568.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
EC1094V2_RS01280 | 67358..70366 | - | 3009 | WP_000718520.1 | Tn3 family transposase | - |
EC1094V2_RS01285 | 70525..70857 | + | 333 | Protein_62 | recombinase family protein | - |
EC1094V2_RS01295 | 71006..71986 | - | 981 | WP_001567981.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..123705 | 123705 | |
- | inside | IScluster/Tn | - | - | 48278..79644 | 31366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12372.11 Da Isoelectric Point: 10.0935
>T293587 WP_000558568.1 NZ_LT883141:c67128-66817 [Escherichia coli]
MHVVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHVVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT293587 WP_000990392.1 NZ_LT883141:c66820-66401 [Escherichia coli]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663AUB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AHC4 |