Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-chpS/PRK09812-ChpS |
Location | 445151..445728 | Replicon | chromosome |
Accession | NZ_LT855380 | ||
Organism | Pseudomonas viridiflava strain CFBP 1590 isolate E12-5 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | CFBP1590_RS02140 | Protein ID | WP_080665327.1 |
Coordinates | 445402..445728 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | A0A5E7C1C9 |
Locus tag | CFBP1590_RS02135 | Protein ID | WP_004880245.1 |
Coordinates | 445151..445405 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP1590_RS02115 | 440538..441929 | + | 1392 | WP_088234402.1 | heavy metal sensor histidine kinase | - |
CFBP1590_RS02120 | 442026..442427 | + | 402 | WP_004880251.1 | MAPEG family protein | - |
CFBP1590_RS02125 | 442763..443170 | - | 408 | WP_043305551.1 | DUF1090 domain-containing protein | - |
CFBP1590_RS02130 | 443225..444907 | - | 1683 | WP_088234403.1 | NAD-dependent DNA ligase LigB | - |
CFBP1590_RS02135 | 445151..445405 | + | 255 | WP_004880245.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
CFBP1590_RS02140 | 445402..445728 | + | 327 | WP_080665327.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CFBP1590_RS02145 | 445673..446863 | - | 1191 | WP_004880242.1 | methionine adenosyltransferase | - |
CFBP1590_RS02150 | 446884..447879 | - | 996 | WP_088234404.1 | ArsR family transcriptional regulator | - |
CFBP1590_RS02155 | 448138..450135 | + | 1998 | WP_029244141.1 | transketolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11913.60 Da Isoelectric Point: 12.3548
>T293576 WP_080665327.1 NZ_LT855380:445402-445728 [Pseudomonas viridiflava]
VKQHGFNRADIVRISLNPTAGREQQRDFRPALVLTPAAYNVTGLAIVAPIIQGGDFARYSGFAVPLGGAGVPNKSPRRLT
SPGAFDDRRRITDRQQRAGRRRGRFFPK
VKQHGFNRADIVRISLNPTAGREQQRDFRPALVLTPAAYNVTGLAIVAPIIQGGDFARYSGFAVPLGGAGVPNKSPRRLT
SPGAFDDRRRITDRQQRAGRRRGRFFPK
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|