Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4196905..4197495 | Replicon | chromosome |
Accession | NZ_LT853885 | ||
Organism | Xanthomonas fragariae strain PD5205 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1Y6HPD3 |
Locus tag | PD5205_RS19575 | Protein ID | WP_002803897.1 |
Coordinates | 4197214..4197495 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PD5205_RS19570 | Protein ID | WP_002803896.1 |
Coordinates | 4196905..4197195 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PD5205_RS19545 | 4192410..4193378 | - | 969 | WP_065975413.1 | IS5 family transposase | - |
PD5205_RS19550 | 4193623..4194636 | - | 1014 | WP_082244192.1 | hypothetical protein | - |
PD5205_RS19555 | 4194817..4195419 | - | 603 | WP_083215096.1 | transposase | - |
PD5205_RS21045 | 4195525..4195827 | - | 303 | WP_145954077.1 | hypothetical protein | - |
PD5205_RS19560 | 4196029..4196361 | + | 333 | WP_002803887.1 | hypothetical protein | - |
PD5205_RS19570 | 4196905..4197195 | - | 291 | WP_002803896.1 | HigA family addiction module antidote protein | Antitoxin |
PD5205_RS19575 | 4197214..4197495 | - | 282 | WP_002803897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PD5205_RS19580 | 4197959..4200034 | - | 2076 | WP_065975458.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4145492..4205567 | 60075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10897.61 Da Isoelectric Point: 9.7550
>T293571 WP_002803897.1 NZ_LT853885:c4197495-4197214 [Xanthomonas fragariae]
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|