Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4236363..4236953 | Replicon | chromosome |
Accession | NZ_LT853882 | ||
Organism | Xanthomonas fragariae strain PD885 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1Y6HPD3 |
Locus tag | PD885_RS19675 | Protein ID | WP_002803897.1 |
Coordinates | 4236672..4236953 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | PD885_RS19670 | Protein ID | WP_002803896.1 |
Coordinates | 4236363..4236653 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PD885_RS19645 | 4231868..4232836 | - | 969 | WP_088057082.1 | IS5 family transposase | - |
PD885_RS19650 | 4233081..4234094 | - | 1014 | WP_082244192.1 | hypothetical protein | - |
PD885_RS19655 | 4234230..4234877 | - | 648 | WP_088057083.1 | transposase | - |
PD885_RS21200 | 4234983..4235285 | - | 303 | WP_145954077.1 | hypothetical protein | - |
PD885_RS19660 | 4235487..4235819 | + | 333 | WP_002803887.1 | hypothetical protein | - |
PD885_RS19670 | 4236363..4236653 | - | 291 | WP_002803896.1 | HigA family addiction module antidote protein | Antitoxin |
PD885_RS19675 | 4236672..4236953 | - | 282 | WP_002803897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PD885_RS19680 | 4237417..4239492 | - | 2076 | WP_065975458.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10897.61 Da Isoelectric Point: 9.7550
>T293565 WP_002803897.1 NZ_LT853882:c4236953-4236672 [Xanthomonas fragariae]
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|