Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4209667..4210257 | Replicon | chromosome |
Accession | NZ_LT853880 | ||
Organism | Xanthomonas fragariae strain NBC2815 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1Y6HPD3 |
Locus tag | NBC2815_RS19535 | Protein ID | WP_002803897.1 |
Coordinates | 4209976..4210257 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | NBC2815_RS19530 | Protein ID | WP_002803896.1 |
Coordinates | 4209667..4209957 (-) | Length | 97 a.a. |
Genomic Context
Location: 4208791..4209123 (333 bp)
Type: Others
Protein ID: WP_002803887.1
Type: Others
Protein ID: WP_002803887.1
Location: 4205665..4206678 (1014 bp)
Type: Others
Protein ID: WP_088062318.1
Type: Others
Protein ID: WP_088062318.1
Location: 4206814..4208181 (1368 bp)
Type: Others
Protein ID: WP_088062671.1
Type: Others
Protein ID: WP_088062671.1
Location: 4208287..4208589 (303 bp)
Type: Others
Protein ID: WP_134656642.1
Type: Others
Protein ID: WP_134656642.1
Location: 4209667..4209957 (291 bp)
Type: Antitoxin
Protein ID: WP_002803896.1
Type: Antitoxin
Protein ID: WP_002803896.1
Location: 4209976..4210257 (282 bp)
Type: Toxin
Protein ID: WP_002803897.1
Type: Toxin
Protein ID: WP_002803897.1
Location: 4210721..4212796 (2076 bp)
Type: Others
Protein ID: WP_088062320.1
Type: Others
Protein ID: WP_088062320.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBC2815_RS19510 | 4205665..4206678 | - | 1014 | WP_088062318.1 | hypothetical protein | - |
NBC2815_RS19515 | 4206814..4208181 | - | 1368 | WP_088062671.1 | IS5 family transposase | - |
NBC2815_RS20750 | 4208287..4208589 | - | 303 | WP_134656642.1 | hypothetical protein | - |
NBC2815_RS19520 | 4208791..4209123 | + | 333 | WP_002803887.1 | hypothetical protein | - |
NBC2815_RS19530 | 4209667..4209957 | - | 291 | WP_002803896.1 | HigA family addiction module antidote protein | Antitoxin |
NBC2815_RS19535 | 4209976..4210257 | - | 282 | WP_002803897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBC2815_RS19540 | 4210721..4212796 | - | 2076 | WP_088062320.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10897.61 Da Isoelectric Point: 9.7550
>T293561 WP_002803897.1 NZ_LT853880:c4210257-4209976 [Xanthomonas fragariae]
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y6HPD3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |