Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4209667..4210257 | Replicon | chromosome |
Accession | NZ_LT853880 | ||
Organism | Xanthomonas fragariae strain NBC2815 |
Toxin (Protein)
Gene name | graT | Uniprot ID | A0A1Y6HPD3 |
Locus tag | NBC2815_RS19535 | Protein ID | WP_002803897.1 |
Coordinates | 4209976..4210257 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | NBC2815_RS19530 | Protein ID | WP_002803896.1 |
Coordinates | 4209667..4209957 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBC2815_RS19510 | 4205665..4206678 | - | 1014 | WP_088062318.1 | hypothetical protein | - |
NBC2815_RS19515 | 4206814..4208181 | - | 1368 | WP_088062671.1 | IS5 family transposase | - |
NBC2815_RS20750 | 4208287..4208589 | - | 303 | WP_134656642.1 | hypothetical protein | - |
NBC2815_RS19520 | 4208791..4209123 | + | 333 | WP_002803887.1 | hypothetical protein | - |
NBC2815_RS19530 | 4209667..4209957 | - | 291 | WP_002803896.1 | HigA family addiction module antidote protein | Antitoxin |
NBC2815_RS19535 | 4209976..4210257 | - | 282 | WP_002803897.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBC2815_RS19540 | 4210721..4212796 | - | 2076 | WP_088062320.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10897.61 Da Isoelectric Point: 9.7550
>T293561 WP_002803897.1 NZ_LT853880:c4210257-4209976 [Xanthomonas fragariae]
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
MIKSIVDKEAEKIWVGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQLRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|