Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 28008..28272 | Replicon | plasmid pWI2-incI1 |
Accession | NZ_LT838204 | ||
Organism | Escherichia coli isolate WI2 isolate |
Toxin (Protein)
Gene name | pndA | Uniprot ID | E6BRV3 |
Locus tag | DSZ51_RS25995 | Protein ID | WP_001303307.1 |
Coordinates | 28008..28160 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 28215..28272 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DSZ51_RS25975 | 23337..25499 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
DSZ51_RS25980 | 25564..26226 | + | 663 | WP_000653333.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
DSZ51_RS25985 | 26298..26507 | - | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
DSZ51_RS26860 | 26850..27026 | + | 177 | WP_001054898.1 | hypothetical protein | - |
DSZ51_RS25990 | 27685..27936 | + | 252 | WP_001291967.1 | hypothetical protein | - |
DSZ51_RS25995 | 28008..28160 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
- | 28215..28272 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28215..28272 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28215..28272 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 28215..28272 | + | 58 | NuclAT_0 | - | Antitoxin |
DSZ51_RS26000 | 28452..29660 | + | 1209 | WP_001303305.1 | IncI1-type conjugal transfer protein TrbA | - |
DSZ51_RS26005 | 29679..30749 | + | 1071 | WP_085543303.1 | IncI1-type conjugal transfer protein TrbB | - |
DSZ51_RS26010 | 30742..33033 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..83831 | 83831 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T293555 WP_001303307.1 NZ_LT838204:c28160-28008 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT293555 NZ_LT838204:28215-28272 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|