Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3736447..3737141 Replicon chromosome
Accession NZ_LT838200
Organism Escherichia coli isolate WI2 isolate

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag DSZ51_RS19365 Protein ID WP_001263489.1
Coordinates 3736447..3736845 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag DSZ51_RS19370 Protein ID WP_000554758.1
Coordinates 3736848..3737141 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- 3732035..3732115 - 81 NuclAT_11 - -
- 3732035..3732115 - 81 NuclAT_11 - -
- 3732035..3732115 - 81 NuclAT_11 - -
- 3732035..3732115 - 81 NuclAT_11 - -
DSZ51_RS19335 3732711..3733169 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
DSZ51_RS19340 3733430..3734887 + 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
DSZ51_RS19345 3734944..3735465 - 522 Protein_3557 peptide chain release factor H -
DSZ51_RS19350 3735461..3735667 - 207 Protein_3558 RtcB family protein -
DSZ51_RS19360 3735985..3736437 - 453 WP_001059892.1 GNAT family N-acetyltransferase -
DSZ51_RS19365 3736447..3736845 - 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
DSZ51_RS19370 3736848..3737141 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
DSZ51_RS19375 3737193..3738248 - 1056 WP_001226164.1 DNA polymerase IV -
DSZ51_RS19380 3738319..3739104 - 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
DSZ51_RS19385 3739076..3740788 + 1713 Protein_3564 flagellar biosynthesis protein FlhA -
DSZ51_RS19390 3741012..3741509 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA 3736447..3751727 15280


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T293548 WP_001263489.1 NZ_LT838200:c3736845-3736447 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT293548 WP_000554758.1 NZ_LT838200:c3737141-3736848 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References