Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 658135..658862 | Replicon | chromosome |
| Accession | NZ_LT838196 | ||
| Organism | Escherichia coli isolate WI1 isolate | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | WI2_RS03435 | Protein ID | WP_000550189.1 |
| Coordinates | 658135..658449 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | WI2_RS03440 | Protein ID | WP_000560255.1 |
| Coordinates | 658446..658862 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WI2_RS03410 | 654301..655287 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
| WI2_RS03415 | 655366..656049 | - | 684 | WP_001183041.1 | vancomycin high temperature exclusion protein | - |
| WI2_RS03420 | 656126..656629 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| WI2_RS03425 | 656714..657850 | + | 1137 | WP_000018690.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| WI2_RS03435 | 658135..658449 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| WI2_RS03440 | 658446..658862 | + | 417 | WP_000560255.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| WI2_RS03445 | 658907..660925 | - | 2019 | WP_000121450.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| WI2_RS03450 | 661251..663602 | - | 2352 | WP_000695495.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T293509 WP_000550189.1 NZ_LT838196:658135-658449 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14951.41 Da Isoelectric Point: 4.5577
>AT293509 WP_000560255.1 NZ_LT838196:658446-658862 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNAPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|