Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1621233..1621795 | Replicon | chromosome |
Accession | NZ_LT827011 | ||
Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1Q1V8 |
Locus tag | BQ9544_RS08755 | Protein ID | WP_000605675.1 |
Coordinates | 1621517..1621795 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | BQ9544_RS08750 | Protein ID | WP_000781364.1 |
Coordinates | 1621233..1621517 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9544_RS08735 | 1616592..1619639 | + | 3048 | WP_012578903.1 | formate dehydrogenase-N subunit alpha | - |
BQ9544_RS08740 | 1619652..1620536 | + | 885 | WP_001240584.1 | formate dehydrogenase N subunit beta | - |
BQ9544_RS08745 | 1620529..1621182 | + | 654 | WP_000045647.1 | formate dehydrogenase-N subunit gamma | - |
BQ9544_RS08750 | 1621233..1621517 | - | 285 | WP_000781364.1 | HigA family addiction module antidote protein | Antitoxin |
BQ9544_RS08755 | 1621517..1621795 | - | 279 | WP_000605675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BQ9544_RS08760 | 1621981..1622991 | - | 1011 | WP_000642413.1 | alcohol dehydrogenase AdhP | - |
BQ9544_RS08765 | 1623125..1624822 | - | 1698 | WP_000433462.1 | malate dehydrogenase | - |
BQ9544_RS08770 | 1624978..1625115 | - | 138 | WP_000841554.1 | stationary-phase-induced ribosome-associated protein | - |
BQ9544_RS08775 | 1625217..1625432 | - | 216 | WP_000495766.1 | biofilm-dependent modulation protein | - |
BQ9544_RS08785 | 1625777..1626208 | + | 432 | WP_000152307.1 | peroxiredoxin OsmC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10537.16 Da Isoelectric Point: 7.3206
>T293494 WP_000605675.1 NZ_LT827011:c1621795-1621517 [Escherichia coli O127:H6]
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
MIMNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDGIWAISVSGNWRITFEFVN
GDAYILDYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|