Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 440568..441186 | Replicon | chromosome |
Accession | NZ_LT827011 | ||
Organism | Escherichia coli O127:H6 isolate EPEC E2348/69 variety |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | BQ9544_RS02180 | Protein ID | WP_001291435.1 |
Coordinates | 440568..440786 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | BQ9544_RS02185 | Protein ID | WP_000344800.1 |
Coordinates | 440812..441186 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ9544_RS02150 | 436457..436768 | - | 312 | WP_000409907.1 | MGMT family protein | - |
BQ9544_RS02160 | 437147..437500 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
BQ9544_RS02165 | 437542..439092 | - | 1551 | WP_001386100.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
BQ9544_RS02170 | 439256..439726 | - | 471 | WP_000136192.1 | YlaC family protein | - |
BQ9544_RS02175 | 439842..440394 | - | 553 | Protein_398 | maltose O-acetyltransferase | - |
BQ9544_RS02180 | 440568..440786 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
BQ9544_RS02185 | 440812..441186 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
BQ9544_RS02190 | 441731..444880 | - | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
BQ9544_RS02195 | 444903..446096 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 435058..436431 | 1373 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T293490 WP_001291435.1 NZ_LT827011:c440786-440568 [Escherichia coli O127:H6]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT293490 WP_000344800.1 NZ_LT827011:c441186-440812 [Escherichia coli O127:H6]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |