Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 73861..74125 Replicon plasmid II
Accession NZ_LT795504
Organism Escherichia coli strain KV7 isolate KV7

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag KJB12_RS25290 Protein ID WP_001387489.1
Coordinates 73973..74125 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 73861..73923 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KJB12_RS25275 (69100) 69100..71391 - 2292 WP_021497839.1 F-type conjugative transfer protein TrbC -
KJB12_RS25280 (71384) 71384..72454 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
KJB12_RS25285 (72473) 72473..73681 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (73861) 73861..73923 - 63 NuclAT_0 - Antitoxin
- (73861) 73861..73923 - 63 NuclAT_0 - Antitoxin
- (73861) 73861..73923 - 63 NuclAT_0 - Antitoxin
- (73861) 73861..73923 - 63 NuclAT_0 - Antitoxin
KJB12_RS25290 (73973) 73973..74125 + 153 WP_001387489.1 Hok/Gef family protein Toxin
KJB12_RS25295 (74197) 74197..74448 - 252 WP_001291964.1 hypothetical protein -
KJB12_RS27180 (74947) 74947..75042 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
KJB12_RS25300 (75107) 75107..75283 - 177 WP_001054898.1 hypothetical protein -
KJB12_RS25310 (77019) 77019..77228 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
KJB12_RS25315 (77300) 77300..77950 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 - 1..111093 111093


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T293481 WP_001387489.1 NZ_LT795504:73973-74125 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT293481 NZ_LT795504:c73923-73861 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References