Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
Location | 4250415..4250827 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | KJB12_RS20185 | Protein ID | WP_000132601.1 |
Coordinates | 4250486..4250827 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | OrzO | ||
Locus tag | - | ||
Coordinates | 4250415..4250491 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS20175 (4247278) | 4247278..4248867 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
KJB12_RS20180 (4248864) | 4248864..4250258 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_12 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_13 | - | Antitoxin |
- (4250415) | 4250415..4250491 | - | 77 | NuclAT_13 | - | Antitoxin |
KJB12_RS20185 (4250486) | 4250486..4250827 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
KJB12_RS20190 (4250989) | 4250989..4252368 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
KJB12_RS20195 (4252368) | 4252368..4253414 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4248864..4263781 | 14917 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T293475 WP_000132601.1 NZ_LT795502:4250486-4250827 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT293475 NZ_LT795502:c4250491-4250415 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|