Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 625064..625863 | Replicon | chromosome |
Accession | NZ_LT795502 | ||
Organism | Escherichia coli strain KV7 isolate KV7 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | KJB12_RS03025 | Protein ID | WP_000347273.1 |
Coordinates | 625064..625528 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | KJB12_RS03030 | Protein ID | WP_001307405.1 |
Coordinates | 625528..625863 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KJB12_RS02995 (620065) | 620065..620499 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
KJB12_RS03000 (620517) | 620517..621395 | - | 879 | Protein_590 | PTS N-acetylgalactosamine transporter subunit IID | - |
KJB12_RS03005 (621385) | 621385..622164 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
KJB12_RS03010 (622175) | 622175..622648 | - | 474 | WP_001626031.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
KJB12_RS03015 (622671) | 622671..623951 | - | 1281 | WP_000681939.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
KJB12_RS03020 (624200) | 624200..625009 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
KJB12_RS03025 (625064) | 625064..625528 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
KJB12_RS03030 (625528) | 625528..625863 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
KJB12_RS03035 (626012) | 626012..627583 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
KJB12_RS03040 (627958) | 627958..629292 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
KJB12_RS03045 (629308) | 629308..630078 | + | 771 | WP_001058233.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T293461 WP_000347273.1 NZ_LT795502:c625528-625064 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |