Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5257182..5257777 | Replicon | chromosome |
Accession | NZ_LT673656 | ||
Organism | Pseudomonas aeruginosa isolate PcyII-10 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PERCYII10_RS24800 | Protein ID | WP_003113526.1 |
Coordinates | 5257499..5257777 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PERCYII10_RS24795 | Protein ID | WP_003113527.1 |
Coordinates | 5257182..5257487 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PERCYII10_RS24780 | 5252458..5255085 | - | 2628 | WP_033976135.1 | protein kinase family protein | - |
PERCYII10_RS29785 | 5255158..5255934 | - | 777 | WP_154070686.1 | hypothetical protein | - |
PERCYII10_RS24785 | 5256136..5256423 | - | 288 | WP_076939040.1 | barstar family protein | - |
PERCYII10_RS24790 | 5256420..5256812 | - | 393 | WP_154070687.1 | hypothetical protein | - |
PERCYII10_RS24795 | 5257182..5257487 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
PERCYII10_RS24800 | 5257499..5257777 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PERCYII10_RS24810 | 5258106..5260334 | + | 2229 | WP_023086667.1 | TonB-dependent receptor | - |
PERCYII10_RS24815 | 5260404..5261051 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PERCYII10_RS24820 | 5261113..5262351 | - | 1239 | WP_019681675.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T293433 WP_003113526.1 NZ_LT673656:c5257777-5257499 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|