Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2476672..2476856 | Replicon | chromosome |
Accession | NZ_LT671859 | ||
Organism | Staphylococcus aureus isolate Clinical isolate |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | EDCC5055_RS13030 | Protein ID | WP_000482650.1 |
Coordinates | 2476749..2476856 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2476672..2476732 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EDCC5055_RS13000 | 2472202..2472369 | - | 168 | WP_001790576.1 | hypothetical protein | - |
EDCC5055_RS13010 | 2472600..2474333 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
EDCC5055_RS13015 | 2474358..2476121 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
- | 2476672..2476732 | + | 61 | - | - | Antitoxin |
EDCC5055_RS13030 | 2476749..2476856 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EDCC5055_RS13035 | 2476990..2477376 | - | 387 | WP_000779358.1 | flippase GtxA | - |
EDCC5055_RS13040 | 2477644..2478786 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
EDCC5055_RS13045 | 2478846..2479505 | + | 660 | WP_000831298.1 | membrane protein | - |
EDCC5055_RS13050 | 2479687..2480898 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
EDCC5055_RS13055 | 2481021..2481494 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T293427 WP_000482650.1 NZ_LT671859:c2476856-2476749 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
Antitoxin
Download Length: 61 bp
>AT293427 NZ_LT671859:2476672-2476732 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|