Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2009035..2009342 | Replicon | chromosome |
Accession | NZ_LT671859 | ||
Organism | Staphylococcus aureus isolate Clinical isolate |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | EDCC5055_RS10365 | Protein ID | WP_011447039.1 |
Coordinates | 2009166..2009342 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2009035..2009174 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EDCC5055_RS10305 | 2004601..2004780 | + | 180 | WP_000669791.1 | hypothetical protein | - |
EDCC5055_RS10315 | 2005091..2005351 | + | 261 | WP_001791826.1 | hypothetical protein | - |
EDCC5055_RS10320 | 2005404..2005754 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
EDCC5055_RS10325 | 2006265..2006600 | - | 336 | Protein_1892 | SH3 domain-containing protein | - |
EDCC5055_RS10345 | 2007251..2007742 | - | 492 | WP_000920038.1 | staphylokinase | - |
EDCC5055_RS10350 | 2007933..2008688 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
EDCC5055_RS10355 | 2008700..2008954 | - | 255 | WP_000611508.1 | phage holin | - |
EDCC5055_RS10360 | 2009006..2009113 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- | 2009035..2009174 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2009035..2009174 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2009035..2009174 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 2009035..2009174 | + | 140 | NuclAT_0 | - | Antitoxin |
EDCC5055_RS10365 | 2009166..2009342 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
EDCC5055_RS10370 | 2009451..2010224 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
EDCC5055_RS10375 | 2010597..2010971 | - | 375 | WP_000340977.1 | hypothetical protein | - |
EDCC5055_RS10380 | 2011027..2011314 | - | 288 | WP_001262621.1 | hypothetical protein | - |
EDCC5055_RS10385 | 2011360..2011512 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2005404..2063165 | 57761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T293419 WP_011447039.1 NZ_LT671859:c2009342-2009166 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT293419 NZ_LT671859:2009035-2009174 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|