Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) sprA1-sprA1AS/-
Location 1848827..1849009 Replicon chromosome
Accession NZ_LT671859
Organism Staphylococcus aureus isolate Clinical isolate

Toxin (Protein)


Gene name sprA1 Uniprot ID -
Locus tag EDCC5055_RS15015 Protein ID WP_001801861.1
Coordinates 1848827..1848922 (+) Length 32 a.a.

Antitoxin (RNA)


Gene name sprA1AS
Locus tag -
Coordinates 1848950..1849009 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EDCC5055_RS09265 1844488..1845114 + 627 WP_000669046.1 hypothetical protein -
EDCC5055_RS09270 1845155..1845499 + 345 WP_000627551.1 DUF3969 family protein -
EDCC5055_RS09275 1845597..1846147 + 551 Protein_1733 hypothetical protein -
EDCC5055_RS09280 1846365..1847006 - 642 WP_000494956.1 ImmA/IrrE family metallo-endopeptidase -
EDCC5055_RS09285 1847120..1847305 - 186 WP_000809857.1 hypothetical protein -
EDCC5055_RS09290 1847307..1847483 - 177 WP_000375476.1 hypothetical protein -
EDCC5055_RS09295 1847494..1847877 - 384 WP_000070811.1 hypothetical protein -
EDCC5055_RS09310 1848481..1848624 - 144 WP_001549059.1 transposase -
EDCC5055_RS15015 1848827..1848922 + 96 WP_001801861.1 type I toxin-antitoxin system Fst family toxin PepA1 Toxin
- 1848950..1849009 - 60 - - Antitoxin
EDCC5055_RS09315 1849045..1849146 + 102 WP_001791893.1 hypothetical protein -
EDCC5055_RS09320 1849124..1849300 - 177 Protein_1741 transposase -
EDCC5055_RS09325 1849494..1849871 - 378 WP_001037045.1 DUF1433 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1841928..1868925 26997


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 32 a.a.        Molecular weight: 3554.32 Da        Isoelectric Point: 10.4449

>T293417 WP_001801861.1 NZ_LT671859:1848827-1848922 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK

Download         Length: 96 bp

Antitoxin


Download         Length: 60 bp

>AT293417 NZ_LT671859:c1849009-1848950 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References