Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1848827..1849009 | Replicon | chromosome |
Accession | NZ_LT671859 | ||
Organism | Staphylococcus aureus isolate Clinical isolate |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EDCC5055_RS15015 | Protein ID | WP_001801861.1 |
Coordinates | 1848827..1848922 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1848950..1849009 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EDCC5055_RS09265 | 1844488..1845114 | + | 627 | WP_000669046.1 | hypothetical protein | - |
EDCC5055_RS09270 | 1845155..1845499 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
EDCC5055_RS09275 | 1845597..1846147 | + | 551 | Protein_1733 | hypothetical protein | - |
EDCC5055_RS09280 | 1846365..1847006 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
EDCC5055_RS09285 | 1847120..1847305 | - | 186 | WP_000809857.1 | hypothetical protein | - |
EDCC5055_RS09290 | 1847307..1847483 | - | 177 | WP_000375476.1 | hypothetical protein | - |
EDCC5055_RS09295 | 1847494..1847877 | - | 384 | WP_000070811.1 | hypothetical protein | - |
EDCC5055_RS09310 | 1848481..1848624 | - | 144 | WP_001549059.1 | transposase | - |
EDCC5055_RS15015 | 1848827..1848922 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1848950..1849009 | - | 60 | - | - | Antitoxin |
EDCC5055_RS09315 | 1849045..1849146 | + | 102 | WP_001791893.1 | hypothetical protein | - |
EDCC5055_RS09320 | 1849124..1849300 | - | 177 | Protein_1741 | transposase | - |
EDCC5055_RS09325 | 1849494..1849871 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1841928..1868925 | 26997 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T293417 WP_001801861.1 NZ_LT671859:1848827-1848922 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT293417 NZ_LT671859:c1849009-1848950 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|