Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
| Location | 2750754..2751997 | Replicon | chromosome |
| Accession | NZ_LT632616 | ||
| Organism | Legionella pneumophila strain ST37 isolate ST37 | ||
Toxin (Protein)
| Gene name | HipT | Uniprot ID | Q5ZSZ6 |
| Locus tag | H044120014_RS12490 | Protein ID | WP_010948074.1 |
| Coordinates | 2751059..2751997 (+) | Length | 313 a.a. |
Antitoxin (Protein)
| Gene name | HipS | Uniprot ID | Q5ZSZ7 |
| Locus tag | H044120014_RS12485 | Protein ID | WP_010948073.1 |
| Coordinates | 2750754..2751062 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H044120014_RS12460 | 2746190..2746555 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
| H044120014_RS12465 | 2746912..2747277 | - | 366 | WP_010948070.1 | TraK family protein | - |
| H044120014_RS15935 | 2747462..2747602 | - | 141 | WP_153802426.1 | hypothetical protein | - |
| H044120014_RS12470 | 2747605..2749356 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
| H044120014_RS12475 | 2749422..2749697 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
| H044120014_RS12480 | 2750530..2750757 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
| H044120014_RS12485 | 2750754..2751062 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
| H044120014_RS12490 | 2751059..2751997 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
| H044120014_RS12500 | 2752540..2753154 | + | 615 | WP_010948075.1 | hypothetical protein | - |
| H044120014_RS12505 | 2753310..2753516 | - | 207 | WP_015444115.1 | hypothetical protein | - |
| H044120014_RS12510 | 2753853..2755121 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
| H044120014_RS12515 | 2755337..2755862 | - | 526 | Protein_2411 | hypothetical protein | - |
| H044120014_RS12520 | 2755862..2756527 | - | 666 | WP_015444114.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2744776..2745951 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T293409 WP_010948074.1 NZ_LT632616:2751059-2751997 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|