293340

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1297658..1297880 Replicon chromosome
Accession NZ_LT615377
Organism Escherichia coli isolate 106

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag BV315_RS07025 Protein ID WP_000170955.1
Coordinates 1297658..1297765 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1297813..1297880 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BV315_RS06985 1293514..1294347 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
BV315_RS06990 1294344..1294736 + 393 WP_000200374.1 invasion regulator SirB2 -
BV315_RS06995 1294740..1295549 + 810 WP_001257044.1 invasion regulator SirB1 -
BV315_RS07000 1295585..1296439 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BV315_RS07005 1296588..1296695 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1296743..1296809 + 67 NuclAT_33 - -
- 1296743..1296809 + 67 NuclAT_33 - -
- 1296743..1296809 + 67 NuclAT_33 - -
- 1296743..1296809 + 67 NuclAT_33 - -
- 1296743..1296809 + 67 NuclAT_35 - -
- 1296743..1296809 + 67 NuclAT_35 - -
- 1296743..1296809 + 67 NuclAT_35 - -
- 1296743..1296809 + 67 NuclAT_35 - -
- 1296743..1296809 + 67 NuclAT_37 - -
- 1296743..1296809 + 67 NuclAT_37 - -
- 1296743..1296809 + 67 NuclAT_37 - -
- 1296743..1296809 + 67 NuclAT_37 - -
- 1296743..1296809 + 67 NuclAT_39 - -
- 1296743..1296809 + 67 NuclAT_39 - -
- 1296743..1296809 + 67 NuclAT_39 - -
- 1296743..1296809 + 67 NuclAT_39 - -
- 1296743..1296809 + 67 NuclAT_41 - -
- 1296743..1296809 + 67 NuclAT_41 - -
- 1296743..1296809 + 67 NuclAT_41 - -
- 1296743..1296809 + 67 NuclAT_41 - -
- 1296743..1296809 + 67 NuclAT_43 - -
- 1296743..1296809 + 67 NuclAT_43 - -
- 1296743..1296809 + 67 NuclAT_43 - -
- 1296743..1296809 + 67 NuclAT_43 - -
- 1296745..1296810 + 66 NuclAT_17 - -
- 1296745..1296810 + 66 NuclAT_17 - -
- 1296745..1296810 + 66 NuclAT_17 - -
- 1296745..1296810 + 66 NuclAT_17 - -
- 1296745..1296810 + 66 NuclAT_20 - -
- 1296745..1296810 + 66 NuclAT_20 - -
- 1296745..1296810 + 66 NuclAT_20 - -
- 1296745..1296810 + 66 NuclAT_20 - -
- 1296745..1296810 + 66 NuclAT_23 - -
- 1296745..1296810 + 66 NuclAT_23 - -
- 1296745..1296810 + 66 NuclAT_23 - -
- 1296745..1296810 + 66 NuclAT_23 - -
- 1296745..1296810 + 66 NuclAT_26 - -
- 1296745..1296810 + 66 NuclAT_26 - -
- 1296745..1296810 + 66 NuclAT_26 - -
- 1296745..1296810 + 66 NuclAT_26 - -
- 1296745..1296810 + 66 NuclAT_29 - -
- 1296745..1296810 + 66 NuclAT_29 - -
- 1296745..1296810 + 66 NuclAT_29 - -
- 1296745..1296810 + 66 NuclAT_29 - -
- 1296745..1296810 + 66 NuclAT_32 - -
- 1296745..1296810 + 66 NuclAT_32 - -
- 1296745..1296810 + 66 NuclAT_32 - -
- 1296745..1296810 + 66 NuclAT_32 - -
BV315_RS07015 1297123..1297230 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1297278..1297345 + 68 NuclAT_16 - -
- 1297278..1297345 + 68 NuclAT_16 - -
- 1297278..1297345 + 68 NuclAT_16 - -
- 1297278..1297345 + 68 NuclAT_16 - -
- 1297278..1297345 + 68 NuclAT_19 - -
- 1297278..1297345 + 68 NuclAT_19 - -
- 1297278..1297345 + 68 NuclAT_19 - -
- 1297278..1297345 + 68 NuclAT_19 - -
- 1297278..1297345 + 68 NuclAT_22 - -
- 1297278..1297345 + 68 NuclAT_22 - -
- 1297278..1297345 + 68 NuclAT_22 - -
- 1297278..1297345 + 68 NuclAT_22 - -
- 1297278..1297345 + 68 NuclAT_25 - -
- 1297278..1297345 + 68 NuclAT_25 - -
- 1297278..1297345 + 68 NuclAT_25 - -
- 1297278..1297345 + 68 NuclAT_25 - -
- 1297278..1297345 + 68 NuclAT_28 - -
- 1297278..1297345 + 68 NuclAT_28 - -
- 1297278..1297345 + 68 NuclAT_28 - -
- 1297278..1297345 + 68 NuclAT_28 - -
- 1297278..1297345 + 68 NuclAT_31 - -
- 1297278..1297345 + 68 NuclAT_31 - -
- 1297278..1297345 + 68 NuclAT_31 - -
- 1297278..1297345 + 68 NuclAT_31 - -
- 1297279..1297344 + 66 NuclAT_34 - -
- 1297279..1297344 + 66 NuclAT_34 - -
- 1297279..1297344 + 66 NuclAT_34 - -
- 1297279..1297344 + 66 NuclAT_34 - -
- 1297279..1297344 + 66 NuclAT_36 - -
- 1297279..1297344 + 66 NuclAT_36 - -
- 1297279..1297344 + 66 NuclAT_36 - -
- 1297279..1297344 + 66 NuclAT_36 - -
- 1297279..1297344 + 66 NuclAT_38 - -
- 1297279..1297344 + 66 NuclAT_38 - -
- 1297279..1297344 + 66 NuclAT_38 - -
- 1297279..1297344 + 66 NuclAT_38 - -
- 1297279..1297344 + 66 NuclAT_40 - -
- 1297279..1297344 + 66 NuclAT_40 - -
- 1297279..1297344 + 66 NuclAT_40 - -
- 1297279..1297344 + 66 NuclAT_40 - -
- 1297279..1297344 + 66 NuclAT_42 - -
- 1297279..1297344 + 66 NuclAT_42 - -
- 1297279..1297344 + 66 NuclAT_42 - -
- 1297279..1297344 + 66 NuclAT_42 - -
- 1297279..1297344 + 66 NuclAT_44 - -
- 1297279..1297344 + 66 NuclAT_44 - -
- 1297279..1297344 + 66 NuclAT_44 - -
- 1297279..1297344 + 66 NuclAT_44 - -
BV315_RS07025 1297658..1297765 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1297813..1297880 + 68 NuclAT_15 - Antitoxin
- 1297813..1297880 + 68 NuclAT_15 - Antitoxin
- 1297813..1297880 + 68 NuclAT_15 - Antitoxin
- 1297813..1297880 + 68 NuclAT_15 - Antitoxin
- 1297813..1297880 + 68 NuclAT_18 - Antitoxin
- 1297813..1297880 + 68 NuclAT_18 - Antitoxin
- 1297813..1297880 + 68 NuclAT_18 - Antitoxin
- 1297813..1297880 + 68 NuclAT_18 - Antitoxin
- 1297813..1297880 + 68 NuclAT_21 - Antitoxin
- 1297813..1297880 + 68 NuclAT_21 - Antitoxin
- 1297813..1297880 + 68 NuclAT_21 - Antitoxin
- 1297813..1297880 + 68 NuclAT_21 - Antitoxin
- 1297813..1297880 + 68 NuclAT_24 - Antitoxin
- 1297813..1297880 + 68 NuclAT_24 - Antitoxin
- 1297813..1297880 + 68 NuclAT_24 - Antitoxin
- 1297813..1297880 + 68 NuclAT_24 - Antitoxin
- 1297813..1297880 + 68 NuclAT_27 - Antitoxin
- 1297813..1297880 + 68 NuclAT_27 - Antitoxin
- 1297813..1297880 + 68 NuclAT_27 - Antitoxin
- 1297813..1297880 + 68 NuclAT_27 - Antitoxin
- 1297813..1297880 + 68 NuclAT_30 - Antitoxin
- 1297813..1297880 + 68 NuclAT_30 - Antitoxin
- 1297813..1297880 + 68 NuclAT_30 - Antitoxin
- 1297813..1297880 + 68 NuclAT_30 - Antitoxin
BV315_RS07035 1298169..1299269 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
BV315_RS07040 1299539..1299769 + 231 WP_001146444.1 putative cation transport regulator ChaB -
BV315_RS07045 1299927..1300622 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
BV315_RS07050 1300666..1301019 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
BV315_RS07055 1301204..1302598 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T293340 WP_000170955.1 NZ_LT615377:c1297765-1297658 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT293340 NZ_LT615377:1297813-1297880 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References