Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 23793..24384 | Replicon | chromosome |
Accession | NZ_LT615228 | ||
Organism | Polynucleobacter necessarius isolate PPGSP1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | DXE33_RS00145 | Protein ID | WP_114638120.1 |
Coordinates | 23793..24071 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DXE33_RS00150 | Protein ID | WP_114639663.1 |
Coordinates | 24082..24384 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE33_RS00125 | 18891..19825 | - | 935 | Protein_24 | uroporphyrinogen-III C-methyltransferase | - |
DXE33_RS00130 | 19860..20462 | - | 603 | WP_114638118.1 | DUF934 domain-containing protein | - |
DXE33_RS00135 | 20459..22187 | - | 1729 | Protein_26 | nitrite/sulfite reductase | - |
DXE33_RS00140 | 22362..23651 | + | 1290 | WP_114638119.1 | serine hydrolase | - |
DXE33_RS00145 | 23793..24071 | + | 279 | WP_114638120.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DXE33_RS00150 | 24082..24384 | + | 303 | WP_114639663.1 | HigA family addiction module antidote protein | Antitoxin |
DXE33_RS00155 | 24423..24794 | - | 372 | WP_114638121.1 | hypothetical protein | - |
DXE33_RS00160 | 24845..25057 | - | 213 | WP_162785383.1 | hypothetical protein | - |
DXE33_RS00165 | 25314..25904 | + | 591 | WP_114638123.1 | HdeD family acid-resistance protein | - |
DXE33_RS00170 | 25954..26211 | + | 258 | WP_114638124.1 | hypothetical protein | - |
DXE33_RS00175 | 26324..26551 | + | 228 | WP_114638125.1 | hypothetical protein | - |
DXE33_RS00180 | 26561..28417 | + | 1857 | WP_114638126.1 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10738.42 Da Isoelectric Point: 9.9804
>T293319 WP_114638120.1 NZ_LT615228:23793-24071 [Polynucleobacter necessarius]
MIHSFSCKDTEDLFNSKSSKKLKGIERVARRKLLQLHAVTVLIDLRIPPGNMLEALSGNRKDQHSIRINNQWRICFKWKE
DGAYSVEIVDYH
MIHSFSCKDTEDLFNSKSSKKLKGIERVARRKLLQLHAVTVLIDLRIPPGNMLEALSGNRKDQHSIRINNQWRICFKWKE
DGAYSVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|