Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2164235..2164451 | Replicon | chromosome |
Accession | NZ_LT615218 | ||
Organism | Staphylococcus aureus strain AUS0325 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | BQ3358_RS11025 | Protein ID | WP_001802298.1 |
Coordinates | 2164347..2164451 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2164235..2164290 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ3358_RS11005 | 2160441..2161106 | - | 666 | WP_001024089.1 | SDR family oxidoreductase | - |
BQ3358_RS11010 | 2161258..2161578 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
BQ3358_RS11015 | 2161580..2162557 | + | 978 | WP_000019733.1 | CDF family zinc efflux transporter CzrB | - |
BQ3358_RS11020 | 2162823..2163914 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2164235..2164290 | + | 56 | - | - | Antitoxin |
BQ3358_RS11025 | 2164347..2164451 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
BQ3358_RS14545 | 2165131..2165289 | + | 159 | WP_001792784.1 | hypothetical protein | - |
BQ3358_RS11030 | 2165947..2166804 | - | 858 | WP_000370925.1 | Cof-type HAD-IIB family hydrolase | - |
BQ3358_RS11035 | 2166872..2167654 | - | 783 | WP_000908185.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T293315 WP_001802298.1 NZ_LT615218:c2164451-2164347 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 56 bp
>AT293315 NZ_LT615218:2164235-2164290 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|