Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 2016323..2016737 Replicon chromosome
Accession NZ_LT615218
Organism Staphylococcus aureus strain AUS0325

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag BQ3358_RS10215 Protein ID WP_001065046.1
Coordinates 2016486..2016737 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag BQ3358_RS14950 Protein ID WP_000028424.1
Coordinates 2016323..2016496 (-) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ3358_RS10155 2011890..2012234 - 345 WP_000817289.1 HNH endonuclease -
BQ3358_RS10160 2012250..2012702 - 453 WP_000406191.1 nucleoside triphosphate pyrophosphohydrolase family protein -
BQ3358_RS10165 2012817..2013287 - 471 WP_000282758.1 hypothetical protein -
BQ3358_RS10175 2013310..2013510 - 201 WP_000265041.1 DUF1514 family protein -
BQ3358_RS10180 2013510..2014158 - 649 Protein_1922 hypothetical protein -
BQ3358_RS10185 2014317..2014466 - 150 WP_000595305.1 transcriptional activator RinB -
BQ3358_RS10190 2014463..2014849 - 387 WP_000592201.1 hypothetical protein -
BQ3358_RS10195 2014846..2015052 - 207 WP_000195803.1 DUF1381 domain-containing protein -
BQ3358_RS10200 2015049..2015294 - 246 WP_001282074.1 hypothetical protein -
BQ3358_RS10205 2015331..2015864 - 534 WP_001061838.1 dUTP diphosphatase -
BQ3358_RS14945 2015879..2016040 - 162 WP_000889682.1 hypothetical protein -
BQ3358_RS10210 2016041..2016322 - 282 WP_049274456.1 hypothetical protein -
BQ3358_RS14950 2016323..2016496 - 174 WP_000028424.1 hypothetical protein Antitoxin
BQ3358_RS10215 2016486..2016737 - 252 WP_001065046.1 DUF1024 family protein Toxin
BQ3358_RS10220 2016752..2016994 - 243 WP_000131381.1 phi PVL orf 51-like protein -
BQ3358_RS10225 2016998..2017366 - 369 WP_000101270.1 hypothetical protein -
BQ3358_RS10230 2017379..2017834 - 456 WP_000401965.1 RusA family crossover junction endodeoxyribonuclease -
BQ3358_RS10235 2017843..2018061 - 219 WP_000338527.1 hypothetical protein -
BQ3358_RS10240 2018068..2018961 - 894 WP_000148327.1 DnaD domain-containing protein -
BQ3358_RS10245 2018991..2019461 - 471 WP_000934762.1 single-stranded DNA-binding protein -
BQ3358_RS10250 2019462..2020079 - 618 WP_072353921.1 MBL fold metallo-hydrolase -
BQ3358_RS10255 2020160..2021080 - 921 WP_000138475.1 recombinase RecT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / sak / hlb / groEL 1987976..2041599 53623
- inside Prophage - map / hlb / scn / sak / hlb / groEL 1984165..2042518 58353


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9377.26 Da        Isoelectric Point: 3.7128

>T293312 WP_001065046.1 NZ_LT615218:c2016737-2016486 [Staphylococcus aureus]
MNNREQIEQSIISASAYNGNDTEGLLKEVEDVYKKAQAFDEILEGLPNAMQDALKEDIGLDEAVGIMTGQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6468.29 Da        Isoelectric Point: 4.2484

>AT293312 WP_000028424.1 NZ_LT615218:c2016496-2016323 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSVISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References