Detailed information of TA system TA293310

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): txpA-SprF3/-
• Location: 1991615..1991914
• Replicon: chromosome
• Accession: NZ_LT615218
• Organism: Staphylococcus aureus strain AUS0325

Toxin (Protein)

• Gene name: txpA
• Uniprot ID: -
• Locus tag: BQ3358_RS14515
• Protein ID: WP_072353918.1
• Coordinates: 1991738..1991914 (-)
• Length: 59 a.a.

Antitoxin (RNA)

Gene name	SprF3
Locus tag	-
Coordinates	1991615..1991670 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BQ3358_RS10010	1987173..1987352	+	180	WP_000669791.1	hypothetical protein	-
BQ3358_RS10020	1987663..1987923	+	261	WP_001791826.1	hypothetical protein	-
BQ3358_RS10025	1987976..1988326	-	351	WP_031906254.1	complement inhibitor SCIN-A	-
BQ3358_RS10030	1988837..1989172	-	336	Protein_1892	SH3 domain-containing protein	-
BQ3358_RS10035	1989823..1990314	-	492	WP_000920038.1	staphylokinase	-
BQ3358_RS10040	1990505..1991260	-	756	WP_000861038.1	CHAP domain-containing protein	-
BQ3358_RS10045	1991272..1991526	-	255	WP_000611512.1	phage holin	-
BQ3358_RS10050	1991578..1991685	+	108	WP_001791821.1	hypothetical protein	-
-	1991607..1991746	+	140	NuclAT_0	-	-
-	1991607..1991746	+	140	NuclAT_0	-	-
-	1991607..1991746	+	140	NuclAT_0	-	-
-	1991607..1991746	+	140	NuclAT_0	-	-
-	1991615..1991670	+	56	-	-	Antitoxin
BQ3358_RS14515	1991738..1991914	-	177	WP_072353918.1	putative holin-like toxin	Toxin
BQ3358_RS10055	1992057..1992431	-	375	WP_000340977.1	hypothetical protein	-
BQ3358_RS10060	1992487..1992774	-	288	WP_001262620.1	hypothetical protein	-
BQ3358_RS10065	1992820..1992972	-	153	WP_001000058.1	hypothetical protein	-
BQ3358_RS10070	1992965..1996747	-	3783	WP_000582132.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	scn / sak / hlb / groEL	1987976..2041599	53623
	-	inside	Prophage	-	map / hlb / scn / sak / hlb / groEL	1984165..2042518	58353

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Small toxic protein BsrE-like (30-58)

Sequences

Toxin

Protein

• Length: 59 a.a.
• Molecular weight: 6810.43 Da
• Isoelectric Point: 9.9479

>T293310 WP_072353918.1 NZ_LT615218:c1991914-1991738 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK

Nucleotide

• Length: 177 bp

Antitoxin

Nucleotide

• Length: 56 bp

>AT293310 NZ_LT615218:1991615-1991670 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG

Structures

Antitoxin