Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF1/- |
Location | 1991607..1991914 | Replicon | chromosome |
Accession | NZ_LT615218 | ||
Organism | Staphylococcus aureus strain AUS0325 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | BQ3358_RS14515 | Protein ID | WP_072353918.1 |
Coordinates | 1991738..1991914 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 1991607..1991746 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ3358_RS10010 | 1987173..1987352 | + | 180 | WP_000669791.1 | hypothetical protein | - |
BQ3358_RS10020 | 1987663..1987923 | + | 261 | WP_001791826.1 | hypothetical protein | - |
BQ3358_RS10025 | 1987976..1988326 | - | 351 | WP_031906254.1 | complement inhibitor SCIN-A | - |
BQ3358_RS10030 | 1988837..1989172 | - | 336 | Protein_1892 | SH3 domain-containing protein | - |
BQ3358_RS10035 | 1989823..1990314 | - | 492 | WP_000920038.1 | staphylokinase | - |
BQ3358_RS10040 | 1990505..1991260 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
BQ3358_RS10045 | 1991272..1991526 | - | 255 | WP_000611512.1 | phage holin | - |
BQ3358_RS10050 | 1991578..1991685 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1991607..1991746 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1991607..1991746 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1991607..1991746 | + | 140 | NuclAT_0 | - | Antitoxin |
- | 1991607..1991746 | + | 140 | NuclAT_0 | - | Antitoxin |
BQ3358_RS14515 | 1991738..1991914 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
BQ3358_RS10055 | 1992057..1992431 | - | 375 | WP_000340977.1 | hypothetical protein | - |
BQ3358_RS10060 | 1992487..1992774 | - | 288 | WP_001262620.1 | hypothetical protein | - |
BQ3358_RS10065 | 1992820..1992972 | - | 153 | WP_001000058.1 | hypothetical protein | - |
BQ3358_RS10070 | 1992965..1996747 | - | 3783 | WP_000582132.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1987976..2041599 | 53623 | |
- | inside | Prophage | - | map / hlb / scn / sak / hlb / groEL | 1984165..2042518 | 58353 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T293309 WP_072353918.1 NZ_LT615218:c1991914-1991738 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT293309 NZ_LT615218:1991607-1991746 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|