Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/-
Location 807395..807809 Replicon chromosome
Accession NZ_LT615218
Organism Staphylococcus aureus strain AUS0325

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag BQ3358_RS03955 Protein ID WP_001065076.1
Coordinates 807395..807646 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag BQ3358_RS14900 Protein ID WP_000028423.1
Coordinates 807636..807809 (+) Length 58 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ3358_RS03895 802935..803405 + 471 WP_069991876.1 single-stranded DNA-binding protein -
BQ3358_RS03900 803435..804319 + 885 WP_000148298.1 DnaD domain protein -
BQ3358_RS03905 804326..804544 + 219 WP_000338528.1 hypothetical protein -
BQ3358_RS03910 804553..804957 + 405 WP_000401972.1 RusA family crossover junction endodeoxyribonuclease -
BQ3358_RS03915 804970..805341 + 372 WP_069991878.1 hypothetical protein -
BQ3358_RS03920 805341..805598 + 258 WP_000022728.1 DUF3310 domain-containing protein -
BQ3358_RS03925 805601..805801 + 201 WP_000235324.1 hypothetical protein -
BQ3358_RS03930 805816..806058 + 243 WP_069991881.1 hypothetical protein -
BQ3358_RS03935 806071..806496 + 426 WP_000694061.1 hypothetical protein -
BQ3358_RS03940 806493..806687 + 195 WP_000983952.1 hypothetical protein -
BQ3358_RS03945 806684..807121 + 438 WP_000982713.1 hypothetical protein -
BQ3358_RS03950 807118..807402 + 285 WP_001105603.1 hypothetical protein -
BQ3358_RS03955 807395..807646 + 252 WP_001065076.1 DUF1024 family protein Toxin
BQ3358_RS14900 807636..807809 + 174 WP_000028423.1 hypothetical protein Antitoxin
BQ3358_RS14905 807810..807971 + 162 WP_000889680.1 hypothetical protein -
BQ3358_RS03960 807986..808513 + 528 WP_001061837.1 dUTPase -
BQ3358_RS03965 808550..808795 + 246 WP_001282074.1 hypothetical protein -
BQ3358_RS03970 808792..808998 + 207 WP_000195832.1 DUF1381 domain-containing protein -
BQ3358_RS03975 808995..809198 + 204 WP_000141259.1 hypothetical protein -
BQ3358_RS03980 809191..809427 + 237 WP_000608283.1 hypothetical protein -
BQ3358_RS03985 809417..809806 + 390 WP_001568228.1 hypothetical protein -
BQ3358_RS03990 809803..809976 + 174 WP_000595258.1 transcriptional activator RinB -
BQ3358_RS03995 809977..810378 + 402 WP_000286968.1 hypothetical protein -
BQ3358_RS04000 810733..811227 + 495 WP_000594088.1 terminase small subunit -
BQ3358_RS04005 811220..812443 + 1224 WP_001037578.1 PBSX family phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 791361..864890 73529
- inside Prophage - vWbp 791361..865710 74349


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1024

(1-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9511.44 Da        Isoelectric Point: 3.7128

>T293306 WP_001065076.1 NZ_LT615218:807395-807646 [Staphylococcus aureus]
MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGLPNAMQDALKEDIYLDEAVGIMVSQVVYKYEEEQE
NEY

Download         Length: 252 bp

Antitoxin


Download         Length: 58 a.a.        Molecular weight: 6482.32 Da        Isoelectric Point: 4.2484

>AT293306 WP_000028423.1 NZ_LT615218:807636-807809 [Staphylococcus aureus]
MSISVGDKVYNHETNESLEIVQLVGDIRDTHYKLSDDSIISIIDFITKPIYLIKGDE

Download         Length: 174 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References