Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
| Location | 215799..216301 | Replicon | chromosome |
| Accession | NZ_LT606950 | ||
| Organism | Polynucleobacter necessarius isolate PPGSP4 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | - |
| Locus tag | BQ1619_RS01225 | Protein ID | WP_114661774.1 |
| Coordinates | 216035..216301 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | BQ1619_RS01220 | Protein ID | WP_114661772.1 |
| Coordinates | 215799..216041 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ1619_RS01190 | 210914..211579 | - | 666 | WP_114661760.1 | adenylate kinase | - |
| BQ1619_RS01195 | 211683..212447 | - | 765 | WP_114661762.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| BQ1619_RS01200 | 212466..212645 | - | 180 | WP_114661764.1 | Trm112 family protein | - |
| BQ1619_RS01205 | 212730..213815 | - | 1086 | WP_114661766.1 | tetraacyldisaccharide 4'-kinase | - |
| BQ1619_RS01210 | 213825..214202 | - | 378 | WP_114661768.1 | biopolymer transporter ExbD | - |
| BQ1619_RS01215 | 214518..215732 | + | 1215 | WP_114661770.1 | exodeoxyribonuclease VII large subunit | - |
| BQ1619_RS01220 | 215799..216041 | + | 243 | WP_114661772.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| BQ1619_RS01225 | 216035..216301 | + | 267 | WP_114661774.1 | Txe/YoeB family addiction module toxin | Toxin |
| BQ1619_RS01230 | 216305..217342 | - | 1038 | WP_114661776.1 | UDP-N-acetylmuramate dehydrogenase | - |
| BQ1619_RS01235 | 217444..217929 | + | 486 | WP_114661778.1 | YajQ family cyclic di-GMP-binding protein | - |
| BQ1619_RS01240 | 217886..218845 | + | 960 | WP_114661779.1 | site-specific tyrosine recombinase XerD | - |
| BQ1619_RS01245 | 218877..219509 | + | 633 | WP_114661780.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
| BQ1619_RS01250 | 219549..219920 | + | 372 | WP_114661781.1 | MAPEG family protein | - |
| BQ1619_RS01255 | 220076..220717 | + | 642 | Protein_256 | GTP cyclohydrolase I | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10418.33 Da Isoelectric Point: 10.3153
>T293298 WP_114661774.1 NZ_LT606950:216035-216301 [Polynucleobacter necessarius]
VVVWDLVYSKYALKDAKKISAAGLKDRAQALLSILEIDPFRIPPPYEKLVGDLKGAYSRRINIQHRLVYEVFRKEKTVRI
LRMWMHYE
VVVWDLVYSKYALKDAKKISAAGLKDRAQALLSILEIDPFRIPPPYEKLVGDLKGAYSRRINIQHRLVYEVFRKEKTVRI
LRMWMHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|