Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-YefM
Location 215799..216301 Replicon chromosome
Accession NZ_LT606950
Organism Polynucleobacter necessarius isolate PPGSP4

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag BQ1619_RS01225 Protein ID WP_114661774.1
Coordinates 216035..216301 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag BQ1619_RS01220 Protein ID WP_114661772.1
Coordinates 215799..216041 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ1619_RS01190 210914..211579 - 666 WP_114661760.1 adenylate kinase -
BQ1619_RS01195 211683..212447 - 765 WP_114661762.1 3-deoxy-manno-octulosonate cytidylyltransferase -
BQ1619_RS01200 212466..212645 - 180 WP_114661764.1 Trm112 family protein -
BQ1619_RS01205 212730..213815 - 1086 WP_114661766.1 tetraacyldisaccharide 4'-kinase -
BQ1619_RS01210 213825..214202 - 378 WP_114661768.1 biopolymer transporter ExbD -
BQ1619_RS01215 214518..215732 + 1215 WP_114661770.1 exodeoxyribonuclease VII large subunit -
BQ1619_RS01220 215799..216041 + 243 WP_114661772.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
BQ1619_RS01225 216035..216301 + 267 WP_114661774.1 Txe/YoeB family addiction module toxin Toxin
BQ1619_RS01230 216305..217342 - 1038 WP_114661776.1 UDP-N-acetylmuramate dehydrogenase -
BQ1619_RS01235 217444..217929 + 486 WP_114661778.1 YajQ family cyclic di-GMP-binding protein -
BQ1619_RS01240 217886..218845 + 960 WP_114661779.1 site-specific tyrosine recombinase XerD -
BQ1619_RS01245 218877..219509 + 633 WP_114661780.1 glycerol-3-phosphate 1-O-acyltransferase PlsY -
BQ1619_RS01250 219549..219920 + 372 WP_114661781.1 MAPEG family protein -
BQ1619_RS01255 220076..220717 + 642 Protein_256 GTP cyclohydrolase I -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(11-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10418.33 Da        Isoelectric Point: 10.3153

>T293298 WP_114661774.1 NZ_LT606950:216035-216301 [Polynucleobacter necessarius]
VVVWDLVYSKYALKDAKKISAAGLKDRAQALLSILEIDPFRIPPPYEKLVGDLKGAYSRRINIQHRLVYEVFRKEKTVRI
LRMWMHYE

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8901.36 Da        Isoelectric Point: 9.6580

>AT293298 WP_114661772.1 NZ_LT606950:215799-216041 [Polynucleobacter necessarius]
MTTLTASEARAGLYRLIDQAAESHKPVLISGKRANAVLISEEDWSAIQETLYLLSIPSMRESIKNAMTEPLAKSKKVLKW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References